Mouse anti-Human CD1B Monoclonal Antibody | anti-CD1B antibody

CD1B (T-cell Surface Glycoprotein CD1b, CD1b) (AP)

Cat. Num. AAA6130433

• Gene Names: CD1B; R1; CD1; CD1A
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CD1B; Monoclonal Antibody; CD1B (T-cell Surface Glycoprotein CD1b; CD1b) (AP); anti-CD1B antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2E4
• Specificity: Recognizes human CD1B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-CD1B antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa19-110 from human CD1B (NP_001755.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDSDSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKY
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CD1B is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-CD1B antibody

CD1b is a 43kD member of the immunoglobulin superfamily also known as R1. It is a type I membrane glycoprotein with structural similarities to MHC class I and is non-covalently associated with B2-microglobulin. In humans, CD1 family consists of group I proteins (CD1a, CD1b, CD1c), group II (CD1d), and group III (CD1e). CD1b plays a role in non-peptide glycolipid antigen presentation to CD1-restricted T cells. It is expressed on cortical double positive and single positive thymocytes, Langerhans cells, and dendritic cells. In addition to antigen presentation, CD1b has been implicated in thymic T cell development.

Product Categories/Family for anti-CD1B antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 4502645
• NCBI GeneID: 910
• NCBI Accession #: NP_001755.1
• NCBI GenBank Nucleotide #: NM_001764
• UniProt Accession #: P29016; Q5TDK9; Q5TDL0; Q9UMM2
• Molecular Weight: 30,740 Da
• NCBI Official Full Name: T-cell surface glycoprotein CD1b
• NCBI Official Synonym Full Names: CD1b molecule
• NCBI Official Symbol: CD1B
• NCBI Official Synonym Symbols: R1; CD1; CD1A
• NCBI Protein Information: T-cell surface glycoprotein CD1b; CD1B antigen, b polypeptide; cortical thymocyte antigen CD1B; differentiation antigen CD1-alpha-3
• UniProt Protein Name: T-cell surface glycoprotein CD1b
• Protein Family: T-cell surface glycoprotein
• UniProt Gene Name: CD1B
• UniProt Entry Name: CD1B_HUMAN

NCBI Description

This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail, and requires vesicular acidification to bind lipid antigens. [provided by RefSeq, Jul 2008]

Uniprot Description

CD1B: Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q23.1

Cellular Component: cell surface; lysosomal membrane; plasma membrane; integral to membrane; endosome membrane

Molecular Function: protein binding; beta-2-microglobulin binding; exogenous lipid antigen binding; endogenous lipid antigen binding

Biological Process: antigen processing and presentation, exogenous lipid antigen via MHC class Ib; immune response