Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interleukin 17F Active Protein | IL17F active protein

Interleukin 17F, Recombinant, Mouse (IL-17F, Interleukin-17F, IL17F)

Gene Names
IL17F; ML1; ML-1; CANDF6; IL-17F
Purity
Highly Purified
~98% (SDS-PAGE, HPLC)
Synonyms
Interleukin 17F; Recombinant; Mouse (IL-17F; Interleukin-17F; IL17F); IL17F active protein
Ordering
For Research Use Only!
Purity/Purification
Highly Purified
~98% (SDS-PAGE, HPLC)
Form/Format
Supplied as a lyophilized powder. Reconstitute with sterile dH2O to 0.1mg/ml.
Sequence
RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDP HRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKV GCTCVKPIVHQAA
Biological Activity
IL-17F is fully bioactive when compared to standard. The ED50 as determined by the dose-dependent induction of IL-6 in NHDF is 1.94ng/ml.
Endotoxin Level
<0.01ng/ug
Preparation and Storage
Lyophilized powder may be stored at -20 degree C. Stable for 12 months at -20 degree C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Related Product Information for IL17F active protein
Homodimeric interleukin-17F is a member of the IL-17 family of six homodimeric proteins (IL-17A-17F). Activated CD4+ T cells have also been shown to produce Mouse IL-17F. Activity studies reveal IL-17A to be the most potent, followed by IL-17A/F and IL-17F 100 fold lower than IL-17A. Recombinant Mouse IL-17F produced in E. coli is a non-glycosylated polypeptide comprised of two monomeric subunit each of mIL-17F. The dimer consists of 266aa, with an approximate molecular weight of 29.8kD
Product Categories/Family for IL17F active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
~29.8kD
NCBI Official Full Name
interleukin-17F
NCBI Official Synonym Full Names
interleukin 17F
NCBI Official Symbol
IL17F
NCBI Official Synonym Symbols
ML1; ML-1; CANDF6; IL-17F
NCBI Protein Information
interleukin-17F; IL-24; cytokine ML-1; mutant IL-17F; interleukin-24
UniProt Protein Name
Interleukin-17F
Protein Family
UniProt Gene Name
IL17F
UniProt Synonym Gene Names
IL24; IL-17F; IL-24
UniProt Entry Name
IL17F_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that shares sequence similarity with IL17. This cytokine is expressed by activated T cells, and has been shown to stimulate the production of several other cytokines, including IL6, IL8, and CSF2/GM_CSF. This cytokine is also found to inhibit the angiogenesis of endothelial cells and induce endothelial cells to produce IL2, TGFB1/TGFB, and monocyte chemoattractant protein-1. [provided by RefSeq, Jul 2008]

Uniprot Description

IL17F: Stimulates the production of other cytokines such as IL- 6, IL-8 and granulocyte colony-stimulating factor, and can regulate cartilage matrix turnover. Stimulates PBMC and T-cell proliferation. Inhibits angiogenesis. Defects in IL17F are the cause of familial candidiasis type 6 (CANDF6). CANDF6 is a rare disorder with altered immune responses and impaired clearance of fungal infections, selective against Candida. It is characterized by persistent and/or recurrent infections of the skin, nails and mucous membranes caused by organisms of the genus Candida, mainly Candida albicans. Belongs to the IL-17 family.

Protein type: Cytokine; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 6p12

Cellular Component: extracellular space; extracellular region

Molecular Function: protein homodimerization activity; hematopoietin/interferon-class (D200-domain) cytokine receptor binding; cytokine binding; cytokine activity

Biological Process: proteoglycan metabolic process; negative regulation of angiogenesis; regulation of interleukin-8 biosynthetic process; regulation of transforming growth factor beta receptor signaling pathway; regulation of granulocyte macrophage colony-stimulating factor biosynthetic process; cytokine biosynthetic process; lymphotoxin A biosynthetic process; cartilage development; regulation of interleukin-2 biosynthetic process; regulation of interleukin-6 biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; inflammatory response

Disease: Candidiasis, Familial, 6

Research Articles on IL17F

Similar Products

Product Notes

The IL17F il17f (Catalog #AAA635776) is an Active Protein and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: RKNPKAGVPA LQKAGNCPPL EDNTVRVDIR IFNQNQGISV PREFQNRSSS PWDYNITRDP HRFPSEIAEA QCRHSGCINA QGQEDSTMNS VAIQQEILVL RREPQGCSNS FRLEKMLLKV GCTCVKPIVH QAA. It is sometimes possible for the material contained within the vial of "Interleukin 17F, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.