Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Neutrophil gelatinase-associated lipocalin (Lcn2) Recombinant Protein | Lcn2 recombinant protein

Recombinant Mouse Neutrophil gelatinase-associated lipocalin (Lcn2)

Gene Names
Lcn2; NRL; 24p3; Sip24; AW212229
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Neutrophil gelatinase-associated lipocalin (Lcn2); Recombinant Mouse Neutrophil gelatinase-associated lipocalin (Lcn2); Lcn2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-200, Full length protein
Sequence
QDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDN
Sequence Length
180
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,875 Da
NCBI Official Full Name
neutrophil gelatinase-associated lipocalin
NCBI Official Synonym Full Names
lipocalin 2
NCBI Official Symbol
Lcn2
NCBI Official Synonym Symbols
NRL; 24p3; Sip24; AW212229
NCBI Protein Information
neutrophil gelatinase-associated lipocalin
UniProt Protein Name
Neutrophil gelatinase-associated lipocalin
UniProt Gene Name
Lcn2
UniProt Synonym Gene Names
NGAL

Uniprot Description

Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development. Binds iron through association with 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis. Involved in innate immunity, possibly by sequestrating iron, leading to limit bacterial growth.

Research Articles on Lcn2

Similar Products

Product Notes

The Lcn2 lcn2 (Catalog #AAA966553) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-200, Full length protein. The amino acid sequence is listed below: QDSTQNLIPA PSLLTVPLQP DFRSDQFRGR WYVVGLAGNA VQKKTEGSFT MYSTIYELQE NNSYNVTSIL VRDQDQGCRY WIRTFVPSSR AGQFTLGNMH RYPQVQSYNV QVATTDYNQF AMVFFRKTSE NKQYFKITLY GRTKELSPEL KERFTRFAKS LGLKDDNIIF SVPTDQCIDN. It is sometimes possible for the material contained within the vial of "Neutrophil gelatinase-associated lipocalin (Lcn2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.