Ras-related protein R-Ras2 (RRAS2) Recombinant Protein | RRAS2 recombinant protein

Recombinant Human Ras-related protein R-Ras2 (RRAS2)

Cat. Num. AAA960636

• Gene Names: RRAS2; TC21
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ras-related protein R-Ras2 (RRAS2); Recombinant Human Ras-related protein R-Ras2 (RRAS2); Ras-related protein R-Ras2; Ras-like protein TC21; Teratocarcinoma oncogene; RRAS2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-204aa; Full Length
• Sequence: AAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHC
• Sequence Length: 200

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for RRAS2 recombinant protein

It is a plasma membrane-associated GTP-binding protein with GTPase activity. Might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins but in an antagonistic fashion.

Product Categories/Family for RRAS2 recombinant protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 156713451
• NCBI GeneID: 22800
• NCBI Accession #: NP_001096139.1
• NCBI GenBank Nucleotide #: NM_001102669.2
• UniProt Accession #: P62070; P17082; B2R9Z3; B7Z5Z2; B7Z6C4; B7Z7H6
• Molecular Weight: 50.1 kDa
• NCBI Official Full Name: ras-related protein R-Ras2 isoform b
• NCBI Official Synonym Full Names: related RAS viral (r-ras) oncogene homolog 2
• NCBI Official Symbol: RRAS2
• NCBI Official Synonym Symbols: TC21
• NCBI Protein Information: ras-related protein R-Ras2; ras-like protein TC21; teratocarcinoma oncogene
• UniProt Protein Name: Ras-related protein R-Ras2
• Protein Family: Ras-related protein
• UniProt Gene Name: RRAS2
• UniProt Synonym Gene Names: TC21
• UniProt Entry Name: RRAS2_HUMAN

NCBI Description

This gene encodes a member of the R-Ras subfamily of Ras-like small GTPases. The encoded protein associates with the plasma membrane and may function as a signal transducer. This protein may play an important role in activating signal transduction pathways that control cell proliferation. Mutations in this gene are associated with the growth of certain tumors. Pseudogenes of this gene are found on chromosomes 1 and 2. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Apr 2010]

Uniprot Description

RRAS2: It is a plasma membrane-associated GTP-binding protein with GTPase activity. Might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins but in an antagonistic fashion. Defects in RRAS2 are a cause of susceptibility to ovarian cancer (OC). The term ovarian cancer defines common malignancies originating from ovarian tissue. Although many histologic types of ovarian tumors have been described, epithelial ovarian carcinoma is the most common form. Ovarian cancers are often asymptomatic and the recognized signs and symptoms, even of late-stage disease, are vague. Consequently, most patients are diagnosed with advanced disease. Belongs to the small GTPase superfamily. Ras family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: G protein, monomeric, Ras; G protein; Motility/polarity/chemotaxis; G protein, monomeric; Oncoprotein

Chromosomal Location of Human Ortholog: 11p15.2

Cellular Component: focal adhesion; membrane; endoplasmic reticulum; plasma membrane

Molecular Function: GTPase activity; protein binding; GTP binding

Biological Process: osteoblast differentiation; metabolic process; Ras protein signal transduction; positive regulation of cell migration