Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RRAS2 expression in transfected 293T cell line by RRAS2 polyclonal antibody. Lane 1: RRAS2 transfected lysate (23.4kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human RRAS2 Polyclonal Antibody | anti-RRAS2 antibody

RRAS2 (Ras-related Protein R-Ras2, Ras-like Protein TC21, Teratocarcinoma Oncogene, TC21) (PE)

Gene Names
RRAS2; TC21
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RRAS2; Polyclonal Antibody; RRAS2 (Ras-related Protein R-Ras2; Ras-like Protein TC21; Teratocarcinoma Oncogene; TC21) (PE); anti-RRAS2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RRAS2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-RRAS2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human RRAS2, aa1-204 (NP_036382.2).
Immunogen Sequence
MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RRAS2 expression in transfected 293T cell line by RRAS2 polyclonal antibody. Lane 1: RRAS2 transfected lysate (23.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RRAS2 expression in transfected 293T cell line by RRAS2 polyclonal antibody. Lane 1: RRAS2 transfected lysate (23.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-RRAS2 antibody
It is a plasma membrane-associated GTP-binding protein with GTPase activity. Might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins but in an antagonistic fashion.
Product Categories/Family for anti-RRAS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,196 Da
NCBI Official Full Name
ras-related protein R-Ras2 isoform a
NCBI Official Synonym Full Names
RAS related 2
NCBI Official Symbol
RRAS2
NCBI Official Synonym Symbols
TC21
NCBI Protein Information
ras-related protein R-Ras2
UniProt Protein Name
Ras-related protein R-Ras2
Protein Family
UniProt Gene Name
RRAS2
UniProt Synonym Gene Names
TC21
UniProt Entry Name
RRAS2_HUMAN

NCBI Description

This gene encodes a member of the R-Ras subfamily of Ras-like small GTPases. The encoded protein associates with the plasma membrane and may function as a signal transducer. This protein may play an important role in activating signal transduction pathways that control cell proliferation. Mutations in this gene are associated with the growth of certain tumors. Pseudogenes of this gene are found on chromosomes 1 and 2. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Apr 2010]

Uniprot Description

RRAS2: It is a plasma membrane-associated GTP-binding protein with GTPase activity. Might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins but in an antagonistic fashion. Defects in RRAS2 are a cause of susceptibility to ovarian cancer (OC). The term ovarian cancer defines common malignancies originating from ovarian tissue. Although many histologic types of ovarian tumors have been described, epithelial ovarian carcinoma is the most common form. Ovarian cancers are often asymptomatic and the recognized signs and symptoms, even of late-stage disease, are vague. Consequently, most patients are diagnosed with advanced disease. Belongs to the small GTPase superfamily. Ras family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: G protein; Oncoprotein; G protein, monomeric, Ras; G protein, monomeric; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 11p15.2

Cellular Component: focal adhesion; membrane; endoplasmic reticulum; plasma membrane

Molecular Function: GTPase activity; protein binding; GTP binding

Biological Process: osteoblast differentiation; metabolic process; Ras protein signal transduction; positive regulation of cell migration

Research Articles on RRAS2

Similar Products

Product Notes

The RRAS2 rras2 (Catalog #AAA6393034) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RRAS2 (Ras-related Protein R-Ras2, Ras-like Protein TC21, Teratocarcinoma Oncogene, TC21) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RRAS2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RRAS2 rras2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RRAS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.