Rabbit anti-Human RRAS2 Polyclonal Antibody | anti-RRAS2 antibody

RRAS2 (Ras-related Protein R-Ras2, Ras-like Protein TC21, Teratocarcinoma Oncogene, TC21) (Biotin)

Cat. Num. AAA6393026

• Gene Names: RRAS2; TC21
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RRAS2; Polyclonal Antibody; RRAS2 (Ras-related Protein R-Ras2; Ras-like Protein TC21; Teratocarcinoma Oncogene; TC21) (Biotin); anti-RRAS2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human RRAS2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-RRAS2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human RRAS2, aa1-204 (NP_036382.2).
• Immunogen Sequence: MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RRAS2 expression in transfected 293T cell line by RRAS2 polyclonal antibody. Lane 1: RRAS2 transfected lysate (23.4kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-RRAS2 antibody

It is a plasma membrane-associated GTP-binding protein with GTPase activity. Might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins but in an antagonistic fashion.

Product Categories/Family for anti-RRAS2 antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 21361416
• NCBI GeneID: 22800
• NCBI Accession #: NP_036382.2
• NCBI GenBank Nucleotide #: NM_012250
• UniProt Accession #: P62070; P17082; B2R9Z3; B7Z5Z2; B7Z6C4; B7Z7H6
• Molecular Weight: 24,196 Da
• NCBI Official Full Name: ras-related protein R-Ras2 isoform a
• NCBI Official Synonym Full Names: RAS related 2
• NCBI Official Symbol: RRAS2
• NCBI Official Synonym Symbols: TC21
• NCBI Protein Information: ras-related protein R-Ras2
• UniProt Protein Name: Ras-related protein R-Ras2
• Protein Family: Ras-related protein
• UniProt Gene Name: RRAS2
• UniProt Synonym Gene Names: TC21
• UniProt Entry Name: RRAS2_HUMAN

NCBI Description

This gene encodes a member of the R-Ras subfamily of Ras-like small GTPases. The encoded protein associates with the plasma membrane and may function as a signal transducer. This protein may play an important role in activating signal transduction pathways that control cell proliferation. Mutations in this gene are associated with the growth of certain tumors. Pseudogenes of this gene are found on chromosomes 1 and 2. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Apr 2010]

Uniprot Description

RRAS2: It is a plasma membrane-associated GTP-binding protein with GTPase activity. Might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins but in an antagonistic fashion. Defects in RRAS2 are a cause of susceptibility to ovarian cancer (OC). The term ovarian cancer defines common malignancies originating from ovarian tissue. Although many histologic types of ovarian tumors have been described, epithelial ovarian carcinoma is the most common form. Ovarian cancers are often asymptomatic and the recognized signs and symptoms, even of late-stage disease, are vague. Consequently, most patients are diagnosed with advanced disease. Belongs to the small GTPase superfamily. Ras family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: G protein; Oncoprotein; G protein, monomeric, Ras; G protein, monomeric; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 11p15.2

Cellular Component: focal adhesion; membrane; endoplasmic reticulum; plasma membrane

Molecular Function: GTPase activity; protein binding; GTP binding

Biological Process: osteoblast differentiation; metabolic process; Ras protein signal transduction; positive regulation of cell migration