ATP synthase F (0) complex subunit B1, mitochondrial (ATP5PB) Recombinant Protein | ATP5PB recombinant protein

Recombinant Human ATP synthase F (0) complex subunit B1, mitochondrial (ATP5PB)

Cat. Num. AAA957392

• Gene Names: ATP5PB; PIG47; ATP5F1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: ATP synthase F (0) complex subunit B1; mitochondrial (ATP5PB); Recombinant Human ATP synthase F (0) complex subunit B1; ATP5PB recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 43-256, Full length protein
• Sequence: PVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM
• Sequence Length: 214

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for ATP5PB recombinant protein

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the b subunit of the proton channel.

NCBI and Uniprot Product Information

• NCBI GI #: 21361565
• NCBI GeneID: 515
• NCBI Accession #: NP_001679.2
• NCBI GenBank Nucleotide #: NM_001688.4
• UniProt Accession #: P24539; Q9BQ68; Q9BRU8
• Molecular Weight: 28,909 Da
• NCBI Official Full Name: ATP synthase F(0) complex subunit B1, mitochondrial
• NCBI Official Synonym Full Names: ATP synthase peripheral stalk-membrane subunit b
• NCBI Official Symbol: ATP5PB
• NCBI Official Synonym Symbols: PIG47; ATP5F1
• NCBI Protein Information: ATP synthase F(0) complex subunit B1, mitochondrial
• UniProt Protein Name: ATP synthase F(0) complex subunit B1, mitochondrial
• UniProt Gene Name: ATP5F1
• UniProt Synonym Gene Names: ATPase subunit b

NCBI Description

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the b subunit of the proton channel. [provided by RefSeq, Jul 2008]

Uniprot Description

Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core, and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha3beta3 subcomplex and subunit a/ATP6 static relative to the rotary elements.