Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human UBE4B Monoclonal Antibody | anti-UBE4B antibody

UBE4B (Ubiquitin Conjugation Factor E4 B, Homozygously Deleted in Neuroblastoma 1, HDNB1, KIAA0684, Ubiquitin Fusion Degradation Protein 2, UFD2) (Biotin)

Gene Names
UBE4B; E4; UFD2; HDNB1; UBOX3; UFD2A
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UBE4B; Monoclonal Antibody; UBE4B (Ubiquitin Conjugation Factor E4 B; Homozygously Deleted in Neuroblastoma 1; HDNB1; KIAA0684; Ubiquitin Fusion Degradation Protein 2; UFD2) (Biotin); E4; UBOX3; UFD2A; anti-UBE4B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
8F9
Specificity
Recognizes human UBE4B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
5518
Applicable Applications for anti-UBE4B antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1075-1173 from UBE4B (NP_006039) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FKLLAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNSDH
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Testing Data

(UBE4B monoclonal antibody Blot analysis of UBE4B expression in HeLa NE)

Testing Data (UBE4B monoclonal antibody Blot analysis of UBE4B expression in HeLa NE)
Product Categories/Family for anti-UBE4B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens ubiquitination factor E4B (UBE4B), transcript variant 2, mRNA
NCBI Official Synonym Full Names
ubiquitination factor E4B
NCBI Official Symbol
UBE4B
NCBI Official Synonym Symbols
E4; UFD2; HDNB1; UBOX3; UFD2A
NCBI Protein Information
ubiquitin conjugation factor E4 B
UniProt Protein Name
Ubiquitin conjugation factor E4 B
UniProt Gene Name
UBE4B
UniProt Entry Name
UBE4B_HUMAN

NCBI Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. This gene is also the strongest candidate in the neuroblastoma tumor suppressor genes. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

UBE4B: Binds to the ubiquitin moieties of preformed conjugates and catalyzes ubiquitin chain assembly in conjunction with E1, E2, and E3. Belongs to the ubiquitin conjugation factor E4 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Ligase; EC 6.3.2.19; EC 6.3.2.-; Ubiquitin conjugating system; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 1p36.3

Cellular Component: cytoplasm; nucleus; ubiquitin ligase complex

Molecular Function: enzyme binding; ligase activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; induction of apoptosis by granzyme; protein ubiquitination during ubiquitin-dependent protein catabolic process; response to UV

Research Articles on UBE4B

Similar Products

Product Notes

The UBE4B ube4b (Catalog #AAA6145041) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBE4B (Ubiquitin Conjugation Factor E4 B, Homozygously Deleted in Neuroblastoma 1, HDNB1, KIAA0684, Ubiquitin Fusion Degradation Protein 2, UFD2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBE4B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBE4B ube4b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBE4B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.