Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mucin-3A (MUC3A) Recombinant Protein | MUC3A recombinant protein

Recombinant Human Mucin-3A (MUC3A) , partial

Gene Names
MUC3A; MUC3; MUC-3A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mucin-3A (MUC3A); Recombinant Human Mucin-3A (MUC3A); partial; MUC3A recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1986-2115
Sequence
PCPGTITITIVPASPTDPCVEMDPSTEATSPPTTPLTVFPFTTEMVTCPTSISIQTTLTTYMDTSSMMPESESSISPNASSSTGTGTVPTNTVFTSTRLP TSETWLSNSSVIPLPLPGVSTIPLTMKPSSS
Sequence Length
2115
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
338,839 Da
NCBI Official Full Name
mucin-3A
NCBI Official Synonym Full Names
mucin 3A, cell surface associated
NCBI Official Symbol
MUC3A
NCBI Official Synonym Symbols
MUC3; MUC-3A
NCBI Protein Information
mucin-3A
UniProt Protein Name
Mucin-3A
Protein Family
UniProt Gene Name
MUC3A
UniProt Synonym Gene Names
MUC-3ACurated

NCBI Description

The mucin genes encode epithelial glycoproteins, some of which are secreted and some membrane bound. Each of the genes contains at least one large domain of tandemly repeated sequence that encodes the peptide sequence rich in serine and/or threonine residues, which carries most of the O-linked glycosylation (Gendler and Spicer, 1995 [PubMed 7778880]).[supplied by OMIM, Aug 2008]

Uniprot Description

Major glycoprotein component of a variety of mucus gels. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. May be involved in ligand binding and intracellular signaling.

Research Articles on MUC3A

Similar Products

Product Notes

The MUC3A muc3a (Catalog #AAA948870) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1986-2115. The amino acid sequence is listed below: PCPGTITITI VPASPTDPCV EMDPSTEATS PPTTPLTVFP FTTEMVTCPT SISIQTTLTT YMDTSSMMPE SESSISPNAS SSTGTGTVPT NTVFTSTRLP TSETWLSN SSVIPLPLPG VSTIPLTMKP SSS . It is sometimes possible for the material contained within the vial of "Mucin-3A (MUC3A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.