Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using OTUD7B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Rabbit OTUD7B Polyclonal Antibody | anti-OTUD7B antibody

OTUD7B Rabbit pAb

Gene Names
OTUD7B; ZA20D1; CEZANNE
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
OTUD7B; Polyclonal Antibody; OTUD7B Rabbit pAb; CEZANNE; ZA20D1; anti-OTUD7B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
SKPGGVGTGLGGSSGTETLEKKKKNSLKSWKGGKEEAAGDGPVSEKPPAESVGNGGSKYSQEVMQSLSILRTAMQGEGKFIFVGTLKMGHRHQYQEEMIQRYLSDAEERFLAEQKQKEAERKIMNGGIGGGPPPAKKPEPDAREEQPTGPPAESRAMAFSTGYPGDFTIPR
Applicable Applications for anti-OTUD7B antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IF: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 530-700 of human OTUD7B (NP_064590.2).
Cellular Location
Cytoplasm, Nucleus
Positive Samples
mouse liver, mouse kidney, mouse brain, rat liver, rat kidney
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using OTUD7B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using OTUD7B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded Human colon using OTUD7B Rabbit pAb at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded Human colon using OTUD7B Rabbit pAb at dilution of 1:100 (40x lens).)

Immunofluorescence (IF)

(Immunofluorescence analysis of L929 cells using OTUD7B antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of L929 cells using OTUD7B antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
843
NCBI Official Full Name
OTU domain-containing protein 7B
NCBI Official Synonym Full Names
OTU deubiquitinase 7B
NCBI Official Symbol
OTUD7B
NCBI Official Synonym Symbols
ZA20D1; CEZANNE
NCBI Protein Information
OTU domain-containing protein 7B; OTU domain containing 7B; zinc finger protein Cezanne; zinc finger, A20 domain containing 1; cellular zinc finger anti-NF-kappaB Cezanne; zinc finger A20 domain-containing protein 1; cellular zinc finger anti-NF-kappa-B p
UniProt Protein Name
OTU domain-containing protein 7B
UniProt Gene Name
OTUD7B
UniProt Synonym Gene Names
ZA20D1
UniProt Entry Name
OTU7B_HUMAN

Uniprot Description

Cezanne: cellular zinc finger anti-NF-kappaB, a negative regulator of NF-kappaB. A novel deubiquitinating enzyme that belongs to the ovarian tumor protein (OTU) superfamily.

Protein type: EC 3.4.19.12; Ubiquitin conjugating system; Protease

Chromosomal Location of Human Ortholog: 1q21.2

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding; ubiquitin-specific protease activity; cysteine-type peptidase activity

Biological Process: mucosal immune response; negative regulation of interleukin-8 production; negative regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of transcription from RNA polymerase II promoter; proteolysis

Research Articles on OTUD7B

Similar Products

Product Notes

The OTUD7B otud7b (Catalog #AAA9142720) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OTUD7B Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's OTUD7B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500-1:2000 IHC: 1:50-1:200 IF: 1:50-1:200. Researchers should empirically determine the suitability of the OTUD7B otud7b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SKPGGVGTGL GGSSGTETLE KKKKNSLKSW KGGKEEAAGD GPVSEKPPAE SVGNGGSKYS QEVMQSLSIL RTAMQGEGKF IFVGTLKMGH RHQYQEEMIQ RYLSDAEERF LAEQKQKEAE RKIMNGGIGG GPPPAKKPEP DAREEQPTGP PAESRAMAFS TGYPGDFTIP R. It is sometimes possible for the material contained within the vial of "OTUD7B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.