Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data

Cathepsin S Active Protein | CTSS active protein

Human CellExp Cathepsin S, human recombinant

Applications
SDS-Page
Purity
>=95%
Synonyms
Cathepsin S; Human CellExp Cathepsin S; human recombinant; CTSS; CTSS active protein
Ordering
For Research Use Only!
Host
HEK 293 cells
Purity/Purification
>=95%
Form/Format
A 0.2 muM filtered solution of 20mM MES, 150mM NaCl, 10% Glycerol, pH 5.5.
Appearance: Liquid
Concentration
0.2 muM (varies by lot)
Sequence
QLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNWILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEIVDHHHHHH
Sequence Length
281
Applicable Applications for CTSS active protein
SDS-PAGE; SEC-HPLC
Endotoxin Level
<1 EU/mug by LAL method
Activity (Specifications/test method)
>1000 mU (1U = 1 umole/min/mg) as determined by Cathepsin S Activity Assay Kit (K144-100).
Biological Activity
>1000 mU (1U = 1 umole/min/mg) as determined by Cathepsin S Activity Assay Kit (K144-100).
Results
>1000 mU (1U = 1 umole/min/mg).
Handling
Centrifuge the vial prior to opening.
Preparation and Storage
At -80 degree C
Shelf Life: 6 months

Testing Data

Testing Data
Related Product Information for CTSS active protein
Background: Cathepsin S (CTSS) is a lysosomal cysteine protease of the papain family and may participate in the degradation of antigenic proteins to peptides for presentation on MHC class II molecules. CTSS is synthesized as inactive precursor of 331 amino acids consisting of a 15-aa signal peptide, a propeptide of 99 aa, and a mature polypeptide of 217 aa. It is activated in the lysosomes by a proteolytic cleavage of the propeptide. The deduced amino acid sequence contains only one potential N-glycosylation site located in the propeptide. Compared with the abundant cathepsins B, L and H, cathepsin S shows a restricted tissue distribution, with highest levels in spleen, heart, and lung. In addition, evidences indicated that cathepsin S generates A beta from amyloidogenic fragments of beta APP in the endosomal/lysosomal compartment, and is implicated in the pathogenesis of Alzheimer's disease (AD) and Down Syndrome (DS).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
~ 37 kDa
NCBI Official Full Name
cathepsin S isoform 2 preproprotein
NCBI Official Synonym Full Names
cathepsin S
NCBI Official Symbol
CTSS
NCBI Protein Information
cathepsin S
UniProt Protein Name
Cathepsin S
Protein Family
UniProt Gene Name
CTSS
UniProt Entry Name
CATS_HUMAN

NCBI Description

The protein encoded by this gene, a member of the peptidase C1 family, is a lysosomal cysteine proteinase that may participate in the degradation of antigenic proteins to peptides for presentation on MHC class II molecules. The encoded protein can function as an elastase over a broad pH range in alveolar macrophages. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Dec 2010]

Uniprot Description

CTSS: Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules. The bond- specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N. Belongs to the peptidase C1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.22.27; Protease

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: lysosomal lumen; extracellular space; membrane; intracellular membrane-bound organelle; lysosome; extracellular region

Molecular Function: collagen binding; proteoglycan binding; fibronectin binding; cysteine-type endopeptidase activity; laminin binding

Biological Process: extracellular matrix organization and biogenesis; adaptive immune response; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent; antigen processing and presentation of exogenous peptide antigen via MHC class II; proteolysis; antigen processing and presentation; extracellular matrix disassembly; collagen catabolic process; antigen processing and presentation of peptide antigen via MHC class I; proteolysis involved in cellular protein catabolic process; toll-like receptor signaling pathway; antigen processing and presentation of exogenous peptide antigen via MHC class I; innate immune response; immune response; positive regulation of inflammatory response

Research Articles on CTSS

Similar Products

Product Notes

The CTSS ctss (Catalog #AAA845140) is an Active Protein produced from HEK 293 cells and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Cathepsin S can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE; SEC-HPLC. Researchers should empirically determine the suitability of the CTSS ctss for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QLHKDPTLDH HWHLWKKTYG KQYKEKNEEA VRRLIWEKNL KFVMLHNLEH SMGMHSYDLG MNHLGDMTSE EVMSLMSSLR VPSQWQRNIT YKSNPNWILP DSVDWREKGC VTEVKYQGSC GACWAFSAVG ALEAQLKLKT GKLVSLSAQN LVDCSTEKYG NKGCNGGFMT TAFQYIIDNK GIDSDASYPY KAMDQKCQYD SKYRAATCSK YTELPYGRED VLKEAVANKG PVSVGVDARH PSFFLYRSGV YYEPSCTQNV NHGVLVVGYG DLNGKEYWLV KNSWGHNFGE EGYIRMARNK GNHCGIASFP SYPEIVDHHH HHH. It is sometimes possible for the material contained within the vial of "Cathepsin S, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.