Interleukin-36 alpha (IL36A) Active Protein | IL36A active protein

Recombinant Human Interleukin-36 alpha (IL36A)

Cat. Num. AAA7115039

• Gene Names: IL36A; FIL1; FIL1E; IL1F6; IL-1F6; IL1(EPSILON); FIL1(EPSILON)
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-36 alpha (IL36A); Recombinant Human Interleukin-36 alpha (IL36A); Interleukin-36 Alpha; FIL1 Epsilon; Interleukin-1 Epsilon; IL-1 Epsilon; Interleukin-1 Family Member 6; IL-1F6; IL36A; FIL1E; IL1E; IL1F6; IL36A active protein

• Host: E Coli
• Specificity: Expressed in immune system and fetal brain, but not in other tissues tested or in multiple hematopoietic cell lines. Predominantly expressed in skin keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Increased in lesional psoriasis skin.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.2
• Sequence Positions: 1-158aa; Full Length
• Sequence: MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
• Sequence Length: 158

• Species: Human
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to inhibit IL-8 secretion in A431 human epithelial carcinoma cells is less than 50 ng/ml.
• Subcellular Location: Secreted
• Protein Families: IL-1 Family
• Classification: Cytokine
• Subdivision: Interleukin
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for IL36A active protein

Relevance: Human Interleukin-36alpha (IL-36alpha) is a secreted cytokine that belongs to the Interleukin 1 cytokine family. IL-36alpha is expressed in the immune system and the fetal brain, but not in other tissues or multiple hematopoietic cell lines. IL-36alpha is the only IL-1 family member found to be expressed on T-cells. IL-36alpha and IL-1F8 are involved in the regulation of adipose tissue gene expression. Importantly, IL-36alpha inhibits PPARgamma expression, which may lead to a reduction in adipocyte differentiation suggesting metabolic effects of this cytokine. IL-36alpha, along with IL-1F8 and IL-1F9, has been shown to act as an agonist by activating the pathway involving NFkappaB and MAPK in an IL-1Rrp2 dependent manner. This suggest that IL-36alpha may signal in a similar fashion to IL-1 and IL-18 in having a binding receptor which upon ligation, recruits a second receptor as a signaling component, forming an active heterodimeric receptor complex.

Function: Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1, and the production of proinflammatory cytokines such as TNF-alpha, IL-8 and IL-6. In cultured monocytes upregulates expression of IL-1A, IL-1B and IL-6. In myeloid dendritic cells involved in cell maturation by upregulating surface expression of CD83, CD86 and HLA-DR. In monocyte-derived dendritic cells facilitates dendritic cell maturation and drives T-cell proliferation. May play a role in proinflammatory effects in the lung.

Product Categories/Family for IL36A active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 7657092
• NCBI GeneID: 27179
• NCBI Accession #: NP_055255.1
• NCBI GenBank Nucleotide #: NM_014440.2
• UniProt Accession #: Q9UHA7
• Molecular Weight: 17.7 kDa
• NCBI Official Full Name: interleukin-36 alpha
• NCBI Official Synonym Full Names: interleukin 36 alpha
• NCBI Official Symbol: IL36A
• NCBI Official Synonym Symbols: FIL1; FIL1E; IL1F6; IL-1F6; IL1(EPSILON); FIL1(EPSILON)
• NCBI Protein Information: interleukin-36 alpha
• UniProt Protein Name: Interleukin-36 alpha
• Protein Family: Interleukin
• UniProt Gene Name: IL36A
• UniProt Synonym Gene Names: FIL1E; IL1E; IL1F6; IL-1 epsilon; IL-1F6
• UniProt Entry Name: IL36A_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this gene has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients. [provided by RefSeq, Nov 2015]

Uniprot Description

IL1F6: Belongs to the IL-1 family.

Protein type: Cytokine

Chromosomal Location of Human Ortholog: 2q12-q14.1

Cellular Component: extracellular space; extracellular region

Molecular Function: interleukin-1 receptor binding; cytokine activity

Biological Process: cytokine and chemokine mediated signaling pathway; positive regulation of interleukin-6 production; innate immune response; immune response; inflammatory response