30S ribosomal protein S10 Recombinant Protein | rpsJ recombinant protein

Recombinant E Coli 30S ribosomal protein S10

Cat. Num. AAA717365

• Gene Names: rpsJ; ECK3308; JW3283; nusE
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: 30S ribosomal protein S10; Recombinant E Coli 30S ribosomal protein S10; rpsJ recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-103aa; Full Length
• Sequence: MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG
• Sequence Length: 103

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for rpsJ recombinant protein

Involved in the binding of tRNA to the ribosomes.

References

The primary structure of protein S10 from the small ribosomal subunit of Escherichia coli.Yaguchi M., Roy C., Wittmann H.G.FEBS Lett. 121:113-116(1980) Regulation of the S10 ribosomal protein operon in E. coli nucleotide sequence at the start of the operon.Olins P.O., Nomura M.Cell 26:205-211(1981) Structure of the Escherichia coli S10 ribosomal protein operon.Zurawski G., Zurawski S.M.Nucleic Acids Res. 13:4521-4526(1985) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12.Link A.J., Robison K., Church G.M.Electrophoresis 18:1259-1313(1997) Noorani S.M., Lindahl L., Zengel J.M. Escherichia coli proteome analysis using the gene-protein database.VanBogelen R.A., Abshire K.Z., Moldover B., Olson E.R., Neidhardt F.C.Electrophoresis 18:1243-1251(1997) Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry.Arnold R.J., Reilly J.P.Anal. Biochem. 269:105-112(1999) All-atom homology model of the Escherichia coli 30S ribosomal subunit.Tung C.-S., Joseph S., Sanbonmatsu K.Y.Nat. Struct. Biol. 9:750-755(2002) Study of the structural dynamics of the E. coli 70S ribosome using real-space refinement.Gao H., Sengupta J., Valle M., Korostelev A., Eswar N., Stagg S.M., Van Roey P., Agrawal R.K., Harvey S.C., Sali A., Chapman M.S., Frank J.Cell 113:789-801(2003) Structures of the bacterial ribosome at 3.5 A resolution.Schuwirth B.S., Borovinskaya M.A., Hau C.W., Zhang W., Vila-Sanjurjo A., Holton J.M., Cate J.H.D.Science 310:827-834(2005)

NCBI and Uniprot Product Information

• NCBI GI #: 16131200
• NCBI GeneID: 947816
• NCBI Accession #: NP_417780.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P0A7R5; P02364; Q2M6Y6
• Molecular Weight: 38.7 kDa
• NCBI Official Full Name: 30S ribosomal subunit protein S10
• NCBI Official Symbol: rpsJ
• NCBI Official Synonym Symbols: ECK3308; JW3283; nusE
• NCBI Protein Information: 30S ribosomal subunit protein S10
• UniProt Protein Name: 30S ribosomal protein S10
• Protein Family: 30S ribosomal protein
• UniProt Gene Name: rpsJ
• UniProt Synonym Gene Names: nusE
• UniProt Entry Name: RS10_ECOLI

NCBI Description

The S10 protein (NusE) is a component of the 30S subunit of the ribosome and, in a complex with NusB, plays a role in transcription antitermination. [More information is available at EcoCyc: EG10909].

Uniprot Description

Involved in the binding of tRNA to the ribosomes.