Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

3-hydroxyacyl-CoA dehydratase 3 (PTPLAD1) Recombinant Protein | PTPLAD1 recombinant protein

Recombinant Human 3-hydroxyacyl-CoA dehydratase 3 (PTPLAD1)

Gene Names
HACD3; BIND1; B-IND1; HSPC121; PTPLAD1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-hydroxyacyl-CoA dehydratase 3 (PTPLAD1); Recombinant Human 3-hydroxyacyl-CoA dehydratase 3 (PTPLAD1); PTPLAD1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-362aa; full length protein
Sequence
MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLE FLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL RAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKESF YDTFHTVADMMYFCQMLAVVETINAAIGVTTSPVLPSLIQLLGRNFILFIIFGTMEEMQN KAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWKVLTWLRYTLWIPLYPLGCLAEAVSVIQS IPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQRRRRYGQKKKK IH
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for PTPLAD1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,431 Da
NCBI Official Full Name
very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3
NCBI Official Synonym Full Names
3-hydroxyacyl-CoA dehydratase 3
NCBI Official Symbol
HACD3
NCBI Official Synonym Symbols
BIND1; B-IND1; HSPC121; PTPLAD1
NCBI Protein Information
very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3
UniProt Protein Name
Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3
UniProt Gene Name
HACD3
UniProt Synonym Gene Names
hB-ind1
UniProt Entry Name
HACD3_HUMAN

Uniprot Description

PTPLAD1: induced by sodium butyrate treatment. A downstream mediator of the monomeric GTPase RAC1.

Protein type: EC 4.2.1.134; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 15q22.2

Cellular Component: cytoplasm; endoplasmic reticulum; endoplasmic reticulum membrane; focal adhesion; integral to membrane; mitochondrion; nuclear membrane

Molecular Function: 3-hydroxyacyl-CoA dehydratase activity; enzyme binding; GTPase activator activity; protein binding

Biological Process: activation of JNK activity; fatty acid elongation; I-kappaB kinase/NF-kappaB cascade; positive regulation of GTPase activity; positive regulation of viral genome replication; positive regulation of viral protein levels in host cell; Rac protein signal transduction; Rho protein signal transduction; small GTPase mediated signal transduction; very-long-chain fatty acid biosynthetic process

Research Articles on PTPLAD1

Similar Products

Product Notes

The PTPLAD1 hacd3 (Catalog #AAA7028263) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-362aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the PTPLAD1 hacd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MENQVLTPHV YWAQRHRELY LRVELSDVQN PAISITENVL HFKAQGHGAK GDNVYEFHLE FLDLVKPEPV YKLTQRQVNI TVQKKVSQWW ERLTKQEKRP LFLAPDFDRW LDESDAEMEL RAKEEERLNK LRLESEGSPE TLTNLRKGYL FMYNLVQFLG FSWIFVNLTV RFCILGKESF YDTFHTVADM MYFCQMLAVV ETINAAIGVT TSPVLPSLIQ LLGRNFILFI IFGTMEEMQN KAVVFFVFYL WSAIEIFRYS FYMLTCIDMD WKVLTWLRYT LWIPLYPLGC LAEAVSVIQS IPIFNETGRF SFTLPYPVKI KVRFSFFLQI YLIMIFLGLY INFRHLYKQR RRRYGQKKKK IH. It is sometimes possible for the material contained within the vial of "3-hydroxyacyl-CoA dehydratase 3 (PTPLAD1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.