Western Blot (WB)
(PTPLAD1 polyclonal antibody. Western Blot analysis of PTPLAD1 expression in human liver.)
Mouse anti-Human PTPLAD1 Polyclonal Antibody | anti-PTPLAD1 antibody
PTPLAD1 (Protein-tyrosine Phosphatase-like A Domain-containing Protein 1, Protein Tyrosine Phosphatase-like Protein PTPLAD1, Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier Protein] Dehydratase 3, 3-hydroxyacyl-CoA Dehydratase 3, HACD3, Butyrate-induced
Gene Names
PTPLAD1; HACD3; B-IND1; HSPC121
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
PTPLAD1; Polyclonal Antibody; PTPLAD1 (Protein-tyrosine Phosphatase-like A Domain-containing Protein 1; Protein Tyrosine Phosphatase-like Protein PTPLAD1; Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier Protein] Dehydratase 3; 3-hydroxyacyl-CoA Dehydratase 3; HACD3; Butyrate-induced; Anti -PTPLAD1 (Protein-tyrosine Phosphatase-like A Domain-containing Protein 1; anti-PTPLAD1 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PTPLAD1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKESFYDTFHTVADMMYFCQMLAVVETINAAIGVTTSPVLPSLIQLLGRNFILFIIFGTMEEMQNKAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWKVLTWLRYTLWIPLYPLGCLAEAVSVIQSIPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQRRRRYGQKKKKIH
Applicable Applications for anti-PTPLAD1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human PTPLAD1, aa1-362 (NP_057479.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(PTPLAD1 polyclonal antibody. Western Blot analysis of PTPLAD1 expression in human liver.)
Western Blot (WB)
(PTPLAD1 polyclonal antibody. Western Blot analysis of PTPLAD1 expression in human liver.)
Western Blot (WB)
(PTPLAD1 polyclonal antibody. Western Blot analysis of PTPLAD1 expression in human placenta.)
Western Blot (WB)
(PTPLAD1 polyclonal antibody. Western Blot analysis of PTPLAD1 expression in human placenta.)
Western Blot (WB)
(Western Blot analysis of PTPLAD1 expression in transfected 293T cell line by PTPLAD1 polyclonal antibody. Lane 1: PTPLAD1 transfected lysate (39.82kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of PTPLAD1 expression in transfected 293T cell line by PTPLAD1 polyclonal antibody. Lane 1: PTPLAD1 transfected lysate (39.82kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-PTPLAD1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
43,160 Da
NCBI Official Full Name
PTPLAD1 protein, partial
NCBI Official Synonym Full Names
protein tyrosine phosphatase-like A domain containing 1
NCBI Official Symbol
PTPLAD1
NCBI Official Synonym Symbols
HACD3; B-IND1; HSPC121
NCBI Protein Information
very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 3; very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 3; hB-ind1; butyrate-induced protein 1; butyrate-induced transcript 1; 3-hydroxyacyl-CoA dehydratase 3; protein tyrosine phosphatase-like protein PTPLAD1; protein-tyrosine phosphatase-like A domain-containing protein 1
UniProt Protein Name
Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 3
UniProt Gene Name
PTPLAD1
UniProt Synonym Gene Names
BIND1; HACD3; HACD3; B-ind1; hB-ind1
UniProt Entry Name
HACD3_HUMAN
Uniprot Description
PTPLAD1: induced by sodium butyrate treatment. A downstream mediator of the monomeric GTPase RAC1.
Protein type: Membrane protein, multi-pass; EC 4.2.1.134; Membrane protein, integral
Chromosomal Location of Human Ortholog: 15q22.2
Cellular Component: endoplasmic reticulum membrane; focal adhesion; endoplasmic reticulum; integral to membrane
Molecular Function: protein binding; enzyme binding; 3-hydroxyacyl-CoA dehydratase activity; GTPase activator activity
Biological Process: I-kappaB kinase/NF-kappaB cascade; positive regulation of viral genome replication; small GTPase mediated signal transduction; very-long-chain fatty acid biosynthetic process; Rac protein signal transduction; fatty acid elongation; positive regulation of viral protein levels in host cell; Rho protein signal transduction; activation of JNK activity; positive regulation of GTPase activity
Research Articles on PTPLAD1
Similar Products
Product Notes
The PTPLAD1 ptplad1 (Catalog #AAA6011505) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PTPLAD1 (Protein-tyrosine Phosphatase-like A Domain-containing Protein 1, Protein Tyrosine Phosphatase-like Protein PTPLAD1, Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier Protein] Dehydratase 3, 3-hydroxyacyl-CoA Dehydratase 3, HACD3, Butyrate-induced reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTPLAD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the PTPLAD1 ptplad1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MENQVLTPHV YWAQRHRELY LRVELSDVQN PAISITENVL HFKAQGHGAK GDNVYEFHLE FLDLVKPEPV YKLTQRQVNI TVQKKVSQWW ERLTKQEKRP LFLAPDFDRW LDESDAEMEL RAKEEERLNK LRLESEGSPE TLTNLRKGYL FMYNLVQFLG FSWIFVNLTV RFCILGKESF YDTFHTVADM MYFCQMLAVV ETINAAIGVT TSPVLPSLIQ LLGRNFILFI IFGTMEEMQN KAVVFFVFYL WSAIEIFRYS FYMLTCIDMD WKVLTWLRYT LWIPLYPLGC LAEAVSVIQS IPIFNETGRF SFTLPYPVKI KVRFSFFLQI YLIMIFLGLY INFRHLYKQR RRRYGQKKKK IH. It is sometimes possible for the material contained within the vial of "PTPLAD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
