CD105/Endoglin, soluble Active Protein | CD105/Endoglin active protein

Human CD105/Endoglin, soluble

Cat. Num. AAA692157

• Gene Names: ENG; END; HHT1; ORW1
• Reactivity: Human
• Purity: > 90% by SDS-PAGE & silver stain
• Synonyms: CD105/Endoglin; soluble; Human CD105/Endoglin; Recombinant Human Soluble CD105/Endoglin; Bone morphogenetic protein receptor type-1A; Activin receptor-like kinase 3; CD292; CD105/Endoglin active protein

• Host: Insect Cells
• Reactivity: Human
• Purity/Purification: > 90% by SDS-PAGE & silver stain
• Form/Format: Lyophilized
• Sequence: ETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGP SQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLV TFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQA QGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHILRVLP GHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTG EYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPLASIVSL HASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKE LVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEA VVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFV QVRVSPSVSEFLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPE GDPRFSFLLHFYTVPIPKTGTLSCTVALRPKTGSQDQEVHRTVFMRLNII SPDLSGCTSHHHHHH
• Sequence Length: 565

• Gene: BMPR1A
• Stabilizer: None
• Reconstitution: The lyophilized s CD105 is soluble in water and most aqueous buffers. The lyophilized s CD105 should be reconstituted in PBS or medium to a concentration not lower than 50ug/ml
• Buffer: PBS
• Biological Activity: Not tested so far
• Preparation and Storage: Lyophilized samples are stable for greater than six months at -20 degree C to -70 degree C. Reconstituted sCD105 should be stored in working aliquots at -20 degree C.; Avoid freeze/thaw cycles.

Testing Data

Related Product Information for CD105/Endoglin active protein

A cDNA sequence encoding the extracellular domain of human Endoglin (Met 1 - Leu 586) was expressed in insect cells. Human Endoglin is a disulfide-linked homodimeric protein. According to N-terminal sequence analysis the primary structure of recombinant mature Endoglin starts at Glu 26. Endoglin has a calculated monomeric molecular mass of 61 kDa but as a result of glycosylation, migrates at approximately 70 - 75 kDa under reducing conditions in SDS-PAGE. Endoglin, also known as CD105, is a Type I integral membrane glycoprotein with a large, disulfide-linked, extracellular region and a short, constitutively phosphorylated, cytoplasmic tail. Two splice variants of human Endoglin, the S-Endoglin and L-Endoglin that differ in the length of their cytoplasmic tails have been identified. Endoglin is highly expressed on vascular endothelial cells, chondrocytes, and syncytiotrophoblasts of term placenta. It is also found on activated monocytes, bone marrow pro-erythroblasts, and leukemic cells of lymphoid and myeloid lineages. Human and mouse Endoglin share approximately 70% and 97 % amino acid sequence identity in their extracellular and intracellular domains, respectively. Endoglin has been shown to be a powerful marker of neovascularization. It is also useful as a functional marker that defines long-term repopulating hematopoietic stem cells.

Product Categories/Family for CD105/Endoglin active protein

Soluble receptors

References

1. Cheifetz et al., J Biol Chem 267:19027, 1992 2. Parker et al., J Bone Miner Res 18:289, 2003 3. Barbara et al., J Biol Chem 274:584, 1999 4. Arthur et al., Dev Biol 217:42, 2000 5. McAllister et al., Nature Genet 8:345, 1994 6. Fonsatti et al., J Cell Physiol 188:1, 2001].

NCBI and Uniprot Product Information

• NCBI GI #: 4557555
• NCBI GeneID: 2022
• NCBI Accession #: NP_000109
• NCBI GenBank Nucleotide #: NM_000118
• UniProt Accession #: P17813; Q14248; Q14926; Q5T9C0
• Molecular Weight: 70 - 75 kDa (Monomer)
• NCBI Official Full Name: endoglin isoform 2
• NCBI Official Synonym Full Names: endoglin
• NCBI Official Symbol: ENG
• NCBI Official Synonym Symbols: END; HHT1; ORW1
• NCBI Protein Information: endoglin; CD105 antigen
• UniProt Protein Name: Endoglin
• UniProt Gene Name: ENG
• UniProt Synonym Gene Names: END
• UniProt Entry Name: EGLN_HUMAN

NCBI Description

This gene encodes a homodimeric transmembrane protein which is a major glycoprotein of the vascular endothelium. This protein is a component of the transforming growth factor beta receptor complex and it binds to the beta1 and beta3 peptides with high affinity. Mutations in this gene cause hereditary hemorrhagic telangiectasia, also known as Osler-Rendu-Weber syndrome 1, an autosomal dominant multisystemic vascular dysplasia. This gene may also be involved in preeclampsia and several types of cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2013]

Uniprot Description

Function: Major glycoprotein of vascular endothelium. Involved in the regulation of angiogenesis. May play a critical role in the binding of endothelial cells to integrins and/or other RGD receptors. Acts as TGF-beta coreceptor and is involved in the TGF-beta/BMP signaling cascade. Required for GDF2/BMP9 signaling through SMAD1 in endothelial cells and modulates TGF-beta1 signaling through SMAD3. Ref.9 Ref.11

Subunit structure: Homodimer that forms a heteromeric complex with the signaling receptors for transforming growth factor-beta: TGFBR1 and/or TGFBR2. It is able to bind TGF-beta 1, and 3 efficiently and TGF-beta 2 less efficiently. Interacts with TCTEX1D4. Interacts with ARRB2. Interacts with GDF2. Ref.6 Ref.7 Ref.9 Ref.10

Subcellular location: Membrane; Single-pass type I membrane protein.

Tissue specificity: Endoglin is restricted to endothelial cells in all tissues except bone marrow.

Involvement in disease: Telangiectasia, hereditary hemorrhagic, 1 (HHT1) [MIM:187300]: A multisystemic vascular dysplasia leading to dilation of permanent blood vessels and arteriovenous malformations of skin, mucosa, and viscera. The disease is characterized by recurrent epistaxis and gastro-intestinal hemorrhage. Visceral involvement includes arteriovenous malformations of the lung, liver, and brain.Note: The disease is caused by mutations affecting the gene represented in this entry.