Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data

CD105/Endoglin, soluble Recombinant Protein | CD105/Endoglin recombinant protein

Human CD105/Endoglin, soluble

Gene Names
ENG; END; HHT1; ORW1
Reactivity
Human
Purity
> 90% by SDS-PAGE & silver stain
Synonyms
CD105/Endoglin; soluble; Human CD105/Endoglin; Recombinant Human Soluble CD105/Endoglin; Bone morphogenetic protein receptor type-1A; Activin receptor-like kinase 3; CD292; CD105/Endoglin recombinant protein
Ordering
For Research Use Only!
Host
Insect Cells
Reactivity
Human
Purity/Purification
> 90% by SDS-PAGE & silver stain
Form/Format
Lyophilized
Sequence
ETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGP SQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLV TFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQA QGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHILRVLP GHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTG EYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPLASIVSL HASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKE LVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEA VVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFV QVRVSPSVSEFLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPE GDPRFSFLLHFYTVPIPKTGTLSCTVALRPKTGSQDQEVHRTVFMRLNII SPDLSGCTSHHHHHH
Sequence Length
565
Buffer
PBS
Preparation and Storage
Lyophilized samples are stable for greater than six months at -20 degree C to -70 degree C. Reconstituted sCD105 should be stored in working aliquots at -20 degree C.

Testing Data

Testing Data
Related Product Information for CD105/Endoglin recombinant protein
A cDNA sequence encoding the extracellular domain of human Endoglin (Met 1 - Leu 586) was expressed in insect cells. Human Endoglin is a disulfide-linked homodimeric protein. According to N-terminal sequence analysis, the primary structure of recombinant mature Endoglin starts at Glu 26. Endoglin has a calculated monomeric molecular mass of 61 kDa but as a result of glycosylation, migrates at approximately 70 - 75 kDa under reducing conditions in SDS-PAGE. Endoglin, also known as CD105, is a Type I integral membrane glycoprotein with a large, disulfide-linked, extracellular region and a short, constitutively phosphorylated, cytoplasmic tail. Two splice variants of human Endoglin, the S-Endoglin and L-Endoglin that differ in the length of their cytoplasmic tails have been identified. Endoglin is highly expressed on vascular endothelial cells, chondrocytes, and syncytiotrophoblasts of term placenta. It is also found on activated monocytes, bone marrow pro-erythroblasts, and leukemic cells of lymphoid and myeloid lineages. Human and mouse Endoglin share approximately 70% and 97 % amino acid sequence identity in their extracellular and intracellular domains, respectively. Endoglin has been shown to be a powerful marker of neovascularization. It is also useful as a functional marker that defines long-term repopulating hematopoietic stem cells.
Product Categories/Family for CD105/Endoglin recombinant protein
References
1. Cheifetz et al., J Biol Chem 267:19027, 1992 2. Parker et al., J Bone Miner Res 18:289, 2003 3. Barbara et al., J Biol Chem 274:584, 1999 4. Arthur et al., Dev Biol 217:42, 2000 5. McAllister et al., Nature Genet 8:345, 1994 6. Fonsatti et al., J Cell Physiol 188:1, 2001].

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70 - 75 kDa (Monomer)
NCBI Official Full Name
endoglin isoform 2
NCBI Official Synonym Full Names
endoglin
NCBI Official Symbol
ENG
NCBI Official Synonym Symbols
END; HHT1; ORW1
NCBI Protein Information
endoglin; CD105 antigen
UniProt Protein Name
Endoglin
UniProt Gene Name
ENG
UniProt Synonym Gene Names
END
UniProt Entry Name
EGLN_HUMAN

NCBI Description

This gene encodes a homodimeric transmembrane protein which is a major glycoprotein of the vascular endothelium. This protein is a component of the transforming growth factor beta receptor complex and it binds to the beta1 and beta3 peptides with high affinity. Mutations in this gene cause hereditary hemorrhagic telangiectasia, also known as Osler-Rendu-Weber syndrome 1, an autosomal dominant multisystemic vascular dysplasia. This gene may also be involved in preeclampsia and several types of cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2013]

Uniprot Description

Function: Major glycoprotein of vascular endothelium. Involved in the regulation of angiogenesis. May play a critical role in the binding of endothelial cells to integrins and/or other RGD receptors. Acts as TGF-beta coreceptor and is involved in the TGF-beta/BMP signaling cascade. Required for GDF2/BMP9 signaling through SMAD1 in endothelial cells and modulates TGF-beta1 signaling through SMAD3. Ref.9 Ref.11

Subunit structure: Homodimer that forms a heteromeric complex with the signaling receptors for transforming growth factor-beta: TGFBR1 and/or TGFBR2. It is able to bind TGF-beta 1, and 3 efficiently and TGF-beta 2 less efficiently. Interacts with TCTEX1D4. Interacts with ARRB2. Interacts with GDF2. Ref.6 Ref.7 Ref.9 Ref.10

Subcellular location: Membrane; Single-pass type I membrane protein.

Tissue specificity: Endoglin is restricted to endothelial cells in all tissues except bone marrow.

Involvement in disease: Telangiectasia, hereditary hemorrhagic, 1 (HHT1) [MIM:187300]: A multisystemic vascular dysplasia leading to dilation of permanent blood vessels and arteriovenous malformations of skin, mucosa, and viscera. The disease is characterized by recurrent epistaxis and gastro-intestinal hemorrhage. Visceral involvement includes arteriovenous malformations of the lung, liver, and brain.Note: The disease is caused by mutations affecting the gene represented in this entry.

Research Articles on CD105/Endoglin

Similar Products

Product Notes

The CD105/Endoglin eng (Catalog #AAA691477) is a Recombinant Protein produced from Insect Cells and is intended for research purposes only. The product is available for immediate purchase. The Human CD105/Endoglin, soluble reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: ETVHCDLQPV GPERGEVTYT TSQVSKGCVA QAPNAILEVH VLFLEFPTGP SQLELTLQAS KQNGTWPREV LLVLSVNSSV FLHLQALGIP LHLAYNSSLV TFQEPPGVNT TELPSFPKTQ ILEWAAERGP ITSAAELNDP QSILLRLGQA QGSLSFCMLE ASQDMGRTLE WRPRTPALVR GCHLEGVAGH KEAHILRVLP GHSAGPRTVT VKVELSCAPG DLDAVLILQG PPYVSWLIDA NHNMQIWTTG EYSFKIFPEK NIRGFKLPDT PQGLLGEARM LNASIVASFV ELPLASIVSL HASSCGGRLQ TSPAPIQTTP PKDTCSPELL MSLIQTKCAD DAMTLVLKKE LVAHLKCTIT GLTFWDPSCE AEDRGDKFVL RSAYSSCGMQ VSASMISNEA VVNILSSSSP QRKKVHCLNM DSLSFQLGLY LSPHFLQASN TIEPGQQSFV QVRVSPSVSE FLLQLDSCHL DLGPEGGTVE LIQGRAAKGN CVSLLSPSPE GDPRFSFLLH FYTVPIPKTG TLSCTVALRP KTGSQDQEVH RTVFMRLNII SPDLSGCTSH HHHHH. It is sometimes possible for the material contained within the vial of "CD105/Endoglin, soluble, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.