Mouse anti-Human GLRX3 Monoclonal Antibody | anti-GLRX3 antibody

GLRX3 (Glutaredoxin-3, PKC-interacting Cousin of Thioredoxin, PICOT, PKC-theta-interacting Protein, PKCq-interacting Protein, Thioredoxin-like Protein 2, TXNL2, HUSSY-22, bA500G10.4, FLJ11864)

Cat. Num. AAA649341

• Gene Names: GLRX3; GRX3; GRX4; GLRX4; PICOT; TXNL2; TXNL3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: GLRX3; Monoclonal Antibody; GLRX3 (Glutaredoxin-3; PKC-interacting Cousin of Thioredoxin; PICOT; PKC-theta-interacting Protein; PKCq-interacting Protein; Thioredoxin-like Protein 2; TXNL2; HUSSY-22; bA500G10.4; FLJ11864); Anti -GLRX3 (Glutaredoxin-3; anti-GLRX3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4B5-2A8
• Specificity: Recognizes human GLRX3.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN

• Applicable Applications for anti-GLRX3 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Full length recombinant corresponding to aa1-335 from GLRX3 (AAH05289) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (62.96kD).)

Western Blot (WB)

(GLRX3 monoclonal antibody Western Blot analysis of GLRX3 expression in Hela.)

Related Product Information for anti-GLRX3 antibody

PKCq is a member of the novel, Ca(2+)-independent PKC subfamily, which plays an important and non-redundant role in several aspects of T cell biology. Mutation of PKCq gene leads to impaired receptor-induced stimulation of the transcription factors AP-1, NF-kappaB and NFAT, which results in defective T cell activation, and to aberrant expression of apoptosis-related proteins, resulting in poor T cell survival. It is the major isoform of PKC that is involved in NF-kB activation induced by CD3-CD28 costimulation. PKCq is expressed mostly in skeletal muscle, megakaryoblastic cells and platelets. Human PKCq gene is localized on human chromosome 10p15.

Product Categories/Family for anti-GLRX3 antibody

Antibodies; Abs to Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 315467838
• NCBI GeneID: 10539
• NCBI Accession #: NP_001186797.1
• NCBI GenBank Nucleotide #: NM_001199868.1
• UniProt Accession #: O76003; Q5JV01; Q96CE0; Q9P1B0; Q9P1B1; B3KMP7; B3KMQ5; D3DRG2
• Molecular Weight: 37,432 Da
• NCBI Official Full Name: glutaredoxin-3
• NCBI Official Synonym Full Names: glutaredoxin 3
• NCBI Official Symbol: GLRX3
• NCBI Official Synonym Symbols: GRX3; GRX4; GLRX4; PICOT; TXNL2; TXNL3
• NCBI Protein Information: glutaredoxin-3; glutaredoxin 4; PKCq-interacting protein; thioredoxin-like protein 2; PKC-theta-interacting protein; PKC-interacting cousin of thioredoxin
• UniProt Protein Name: Glutaredoxin-3
• Protein Family: Glutaredoxin
• UniProt Gene Name: GLRX3
• UniProt Synonym Gene Names: PICOT; TXNL2; PICOT
• UniProt Entry Name: GLRX3_HUMAN

NCBI Description

This gene encodes a member of the glutaredoxin family. Glutaredoxins are oxidoreductase enzymes that reduce a variety of substrates using glutathione as a cofactor. The encoded protein binds to and modulates the function of protein kinase C theta. The encoded protein may also inhibit apoptosis and play a role in cellular growth, and the expression of this gene may be a marker for cancer. Pseudogenes of this gene are located on the short arm of chromosomes 6 and 9. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2010]

Uniprot Description

Function: Critical negative regulator of cardiac hypertrophy and a positive inotropic regulator

By similarity. May play a role in regulating the function of the thioredoxin system. Does not posses any thyoredoxin activity since it lacks the conserved motif that is essential for catalytic activity.

Subunit structure: Monomer and homodimer; the homodimer is probably linked by 2 2Fe-2S clusters that may serve as a redox sensor. The monomer interacts with other proteins. Interacts (via N-terminus) with PRKCQ/PKC-theta. Interacts (via C-terminus) with CSRP3

By similarity. Interacts with CSRP2

By similarity. Ref.1 Ref.8

Subcellular location: Cytoplasm › cell cortex. Cytoplasm › myofibril › sarcomere › Z line

By similarity. Note: Under the plasma membrane. After PMA stimulation, GLRX3 and PRKCQ/PKC-theta translocate to a more extended submembrane area. In the Z line, found associated with CSRP3

By similarity. Ref.1

Tissue specificity: Expressed in heart, spleen, testis and, to a lower extent, in thymus and peripheral blood leukocytes. Weakly expressed in lung, placenta, colon and small intestine.

Domain: The thioredoxin domain lacks the two redox-active cysteines. This strongly suggests that it lacks thioredoxin activity.

Sequence similarities: Contains 2 glutaredoxin domains.Contains 1 thioredoxin domain.