Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Glutaredoxin-3 (GLRX3) Recombinant Protein | GLRX3 recombinant protein

Recombinant Human Glutaredoxin-3 (GLRX3)

Gene Names
GLRX3; GRX3; GRX4; GLRX4; PICOT; TXNL2; TXNL3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glutaredoxin-3 (GLRX3); Recombinant Human Glutaredoxin-3 (GLRX3); Glutaredoxin-3; PKC-interacting cousin of thioredoxin; PICOT; PKC-theta-interacting protein; PKCq-interacting protein; Thioredoxin-like protein 2; GLRX3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-335aa; Full Length
Sequence
AAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN
Sequence Length
334
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for GLRX3 recombinant protein
Critical negative regulator of cardiac hypertrophy and a positive inotropic regulator . Crucial regulator of cellular iron homeostasis and hemoglobin maturation. May play a role in regulating the function of the thioredoxin system. Does not posses any thyoredoxin activity since it lacks the conserved motif that is essential for catalytic activity.
Product Categories/Family for GLRX3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64.3 kDa
NCBI Official Full Name
glutaredoxin-3
NCBI Official Synonym Full Names
glutaredoxin 3
NCBI Official Symbol
GLRX3
NCBI Official Synonym Symbols
GRX3; GRX4; GLRX4; PICOT; TXNL2; TXNL3
NCBI Protein Information
glutaredoxin-3; glutaredoxin 4; PKCq-interacting protein; thioredoxin-like protein 2; PKC-theta-interacting protein; PKC-interacting cousin of thioredoxin
UniProt Protein Name
Glutaredoxin-3
Protein Family
UniProt Gene Name
GLRX3
UniProt Synonym Gene Names
PICOT; TXNL2; PICOT; PKCq-interacting protein
UniProt Entry Name
GLRX3_HUMAN

NCBI Description

This gene encodes a member of the glutaredoxin family. Glutaredoxins are oxidoreductase enzymes that reduce a variety of substrates using glutathione as a cofactor. The encoded protein binds to and modulates the function of protein kinase C theta. The encoded protein may also inhibit apoptosis and play a role in cellular growth, and the expression of this gene may be a marker for cancer. Pseudogenes of this gene are located on the short arm of chromosomes 6 and 9. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2010]

Uniprot Description

GLRX3: Critical negative regulator of cardiac hypertrophy and a positive inotropic regulator. May play a role in regulating the function of the thioredoxin system. Does not posses any thyoredoxin activity since it lacks the conserved motif that is essential for catalytic activity.

Protein type: Oxidoreductase

Chromosomal Location of Human Ortholog: 10q26

Cellular Component: cell cortex; Z disc

Molecular Function: protein binding; protein kinase C binding; electron carrier activity; metal ion binding; iron-sulfur cluster binding; protein disulfide oxidoreductase activity

Biological Process: cell redox homeostasis; regulation of the force of heart contraction

Research Articles on GLRX3

Similar Products

Product Notes

The GLRX3 glrx3 (Catalog #AAA1118021) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-335aa; Full Length. The amino acid sequence is listed below: AAGAAEAAVA AVEEVGSAGQ FEELLRLKAK SLLVVHFWAP WAPQCAQMNE VMAELAKELP QVSFVKLEAE GVPEVSEKYE ISSVPTFLFF KNSQKIDRLD GAHAPELTKK VQRHASSGSF LPSANEHLKE DLNLRLKKLT HAAPCMLFMK GTPQEPRCGF SKQMVEILHK HNIQFSSFDI FSDEEVRQGL KAYSSWPTYP QLYVSGELIG GLDIIKELEA SEELDTICPK APKLEERLKV LTNKASVMLF MKGNKQEAKC GFSKQILEIL NSTGVEYETF DILEDEEVRQ GLKAYSNWPT YPQLYVKGEL VGGLDIVKEL KENGELLPIL RGEN. It is sometimes possible for the material contained within the vial of "Glutaredoxin-3 (GLRX3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.