Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (GLRX3 rabbit polyclonal antibody. Western Blot analysis of GLRX3 expression in human pancreas.)

Rabbit anti-Human, Mouse GLRX3 Polyclonal Antibody | anti-GLRX3 antibody

GLRX3 (Glutaredoxin-3, PKC-interacting Cousin of Thioredoxin, PICOT, PKC-theta-interacting Protein, PKCq-interacting Protein, Thioredoxin-like Protein 2, TXNL2, HUSSY-22, bA500G10.4, FLJ11864)

Gene Names
GLRX3; GRX3; GRX4; GLRX4; PICOT; TXNL2; TXNL3
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
GLRX3; Polyclonal Antibody; GLRX3 (Glutaredoxin-3; PKC-interacting Cousin of Thioredoxin; PICOT; PKC-theta-interacting Protein; PKCq-interacting Protein; Thioredoxin-like Protein 2; TXNL2; HUSSY-22; bA500G10.4; FLJ11864); Anti -GLRX3 (Glutaredoxin-3; anti-GLRX3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GLRX3. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN
Applicable Applications for anti-GLRX3 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full-length human GLRX3, aa1-335 (NP_006532.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(GLRX3 rabbit polyclonal antibody. Western Blot analysis of GLRX3 expression in human pancreas.)

Western Blot (WB) (GLRX3 rabbit polyclonal antibody. Western Blot analysis of GLRX3 expression in human pancreas.)

Western Blot (WB)

(GLRX3 rabbit polyclonal antibody. Western Blot analysis of GLRX3 expression in mouse liver.)

Western Blot (WB) (GLRX3 rabbit polyclonal antibody. Western Blot analysis of GLRX3 expression in mouse liver.)

Western Blot (WB)

(GLRX3 rabbit polyclonal antibody. Western Blot analysis of GLRX3 expression in K-562.)

Western Blot (WB) (GLRX3 rabbit polyclonal antibody. Western Blot analysis of GLRX3 expression in K-562.)

Western Blot (WB)

(Western Blot analysis of GLRX3 expression in transfected 293T cell line by GLRX3 polyclonal antibody. Lane 1: GLRX3 transfected lysate (37.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GLRX3 expression in transfected 293T cell line by GLRX3 polyclonal antibody. Lane 1: GLRX3 transfected lysate (37.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GLRX3 antibody
PKCq is a member of the novel, Ca(2+)-independent PKC subfamily, which plays an important and non-redundant role in several aspects of T cell biology. Mutation of PKCq gene leads to impaired receptor-induced stimulation of the transcription factors AP-1, NF-kappaB and NFAT, which results in defective T cell activation, and to aberrant expression of apoptosis-related proteins, resulting in poor T cell survival. It is the major isoform of PKC that is involved in NF-kB activation induced by CD3-CD28 costimulation. PKCq is expressed mostly in skeletal muscle, megakaryoblastic cells and platelets. Human PKCq gene is localized on human chromosome 10p15.
Product Categories/Family for anti-GLRX3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,432 Da
NCBI Official Full Name
glutaredoxin-3
NCBI Official Synonym Full Names
glutaredoxin 3
NCBI Official Symbol
GLRX3
NCBI Official Synonym Symbols
GRX3; GRX4; GLRX4; PICOT; TXNL2; TXNL3
NCBI Protein Information
glutaredoxin-3; glutaredoxin 4; PKCq-interacting protein; thioredoxin-like protein 2; PKC-theta-interacting protein; PKC-interacting cousin of thioredoxin
UniProt Protein Name
Glutaredoxin-3
Protein Family
UniProt Gene Name
GLRX3
UniProt Synonym Gene Names
PICOT; TXNL2; PICOT
UniProt Entry Name
GLRX3_HUMAN

NCBI Description

This gene encodes a member of the glutaredoxin family. Glutaredoxins are oxidoreductase enzymes that reduce a variety of substrates using glutathione as a cofactor. The encoded protein binds to and modulates the function of protein kinase C theta. The encoded protein may also inhibit apoptosis and play a role in cellular growth, and the expression of this gene may be a marker for cancer. Pseudogenes of this gene are located on the short arm of chromosomes 6 and 9. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2010]

Uniprot Description

GLRX3: Critical negative regulator of cardiac hypertrophy and a positive inotropic regulator. May play a role in regulating the function of the thioredoxin system. Does not posses any thyoredoxin activity since it lacks the conserved motif that is essential for catalytic activity.

Protein type: Oxidoreductase

Chromosomal Location of Human Ortholog: 10q26

Cellular Component: cell cortex; Z disc

Molecular Function: protein binding; electron carrier activity; protein kinase C binding; metal ion binding; protein disulfide oxidoreductase activity; iron-sulfur cluster binding

Biological Process: cell redox homeostasis; regulation of the force of heart contraction

Research Articles on GLRX3

Similar Products

Product Notes

The GLRX3 glrx3 (Catalog #AAA6004932) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GLRX3 (Glutaredoxin-3, PKC-interacting Cousin of Thioredoxin, PICOT, PKC-theta-interacting Protein, PKCq-interacting Protein, Thioredoxin-like Protein 2, TXNL2, HUSSY-22, bA500G10.4, FLJ11864) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's GLRX3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the GLRX3 glrx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAGAAEAAV AAVEEVGSAG QFEELLRLKA KSLLVVHFWA PWAPQCAQMN EVMAELAKEL PQVSFVKLEA EGVPEVSEKY EISSVPTFLF FKNSQKIDRL DGAHAPELTK KVQRHASSGS FLPSANEHLK EDLNLRLKKL THAAPCMLFM KGTPQEPRCG FSKQMVEILH KHNIQFSSFD IFSDEEVRQG LKAYSSWPTY PQLYVSGELI GGLDIIKELE ASEELDTICP KAPKLEERLK VLTNKASVML FMKGNKQEAK CGFSKQILEI LNSTGVEYET FDILEDEEVR QGLKAYSNWP TYPQLYVKGE LVGGLDIVKE LKENGELLPI LRGEN. It is sometimes possible for the material contained within the vial of "GLRX3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.