Mouse anti-Human GLRX3 Monoclonal Antibody | anti-GLRX3 antibody

GLRX3 (Glutaredoxin-3, PKC-interacting Cousin of Thioredoxin, PICOT, PKC-theta-interacting Protein, PKCq-interacting Protein, Thioredoxin-like Protein 2, TXNL2, HUSSY-22, bA500G10.4, FLJ11864) (PE)

Cat. Num. AAA6157997

• Gene Names: GLRX3; GRX3; GRX4; GLRX4; PICOT; TXNL2; TXNL3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GLRX3; Monoclonal Antibody; GLRX3 (Glutaredoxin-3; PKC-interacting Cousin of Thioredoxin; PICOT; PKC-theta-interacting Protein; PKCq-interacting Protein; Thioredoxin-like Protein 2; TXNL2; HUSSY-22; bA500G10.4; FLJ11864) (PE); anti-GLRX3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4B5-2A8
• Specificity: Recognizes human GLRX3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-GLRX3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-335 from GLRX3 (AAH05289) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (62.96kD).)

Western Blot (WB)

(GLRX3 monoclonal antibody Western Blot analysis of GLRX3 expression in Hela.)

Related Product Information for anti-GLRX3 antibody

PKCq is a member of the novel, Ca(2+)-independent PKC subfamily, which plays an important and non-redundant role in several aspects of T cell biology. Mutation of PKCq gene leads to impaired receptor-induced stimulation of the transcription factors AP-1, NF-kappaB and NFAT, which results in defective T cell activation, and to aberrant expression of apoptosis-related proteins, resulting in poor T cell survival. It is the major isoform of PKC that is involved in NF-kB activation induced by CD3-CD28 costimulation. PKCq is expressed mostly in skeletal muscle, megakaryoblastic cells and platelets. Human PKCq gene is localized on human chromosome 10p15.

Product Categories/Family for anti-GLRX3 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 13528998
• NCBI GeneID: 10539
• Molecular Weight: 37,432 Da
• NCBI Official Full Name: Homo sapiens glutaredoxin 3, mRNA
• NCBI Official Synonym Full Names: glutaredoxin 3
• NCBI Official Symbol: GLRX3
• NCBI Official Synonym Symbols: GRX3; GRX4; GLRX4; PICOT; TXNL2; TXNL3
• NCBI Protein Information: glutaredoxin-3
• Protein Family: Glutaredoxin

NCBI Description

This gene encodes a member of the glutaredoxin family. Glutaredoxins are oxidoreductase enzymes that reduce a variety of substrates using glutathione as a cofactor. The encoded protein binds to and modulates the function of protein kinase C theta. The encoded protein may also inhibit apoptosis and play a role in cellular growth, and the expression of this gene may be a marker for cancer. Pseudogenes of this gene are located on the short arm of chromosomes 6 and 9. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2010]