Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SEMA6D rabbit polyclonal antibody. Western Blot analysis of SEMA6D expression in mouse lung.)

Rabbit anti-Human, Mouse Semaphorin 6D Polyclonal Antibody | anti-SEMA6D antibody

Semaphorin 6D (Semaphorin-6D, SEMA6D, KIAA1479) APC

Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Semaphorin 6D; Polyclonal Antibody; Semaphorin 6D (Semaphorin-6D; SEMA6D; KIAA1479) APC; anti-SEMA6D antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SEMA6D. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
476
Applicable Applications for anti-SEMA6D antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SEMA6D, aa1-476 (NP_079242.2).
Immunogen Sequence
MRVFLLCAYILLLMVSQLRAVSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLYIAGRDQVYTVNLNEMPKTEVIPNKKLTWRSRQQDRENCAMKGKHKDECHNFIKVFVPRNDEMVFVCGTNAFNPMCRYYRLSTLEYDGEEISGLARCPFDARQTNVALFADGKLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGNYVYFFFREIAVEHNNLGKAVYSRVARICKNDMGGSQRVLEKHWTSFLKARLNCSVPGDSFFYFDVLQSITDIIQINGIPTVVGVFTTQLNSIPGSAVCAFSMDDIEKVFKGRFKEQKTPDSVWTAVPEDKVPKPRPGCCAKHGLAEAYKTSIDFPDETLSFIKSHPLMDSAVPPIADEPWFTKTRVRYRLTAISVDHSAGPYQNYTVIFVGSEAGMVLKVLAKTSPFSLNDSVLLEEIEAYNHAK
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SEMA6D rabbit polyclonal antibody. Western Blot analysis of SEMA6D expression in mouse lung.)

Western Blot (WB) (SEMA6D rabbit polyclonal antibody. Western Blot analysis of SEMA6D expression in mouse lung.)

Western Blot (WB)

(SEMA6D rabbit polyclonal antibody. Western Blot analysis of SEMA6D expression in Jurkat.)

Western Blot (WB) (SEMA6D rabbit polyclonal antibody. Western Blot analysis of SEMA6D expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of SEMA6D expression in transfected 293T cell line by SEMA6D polyclonal antibody. Lane 1: SEMA6D transfected lysate (54.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SEMA6D expression in transfected 293T cell line by SEMA6D polyclonal antibody. Lane 1: SEMA6D transfected lysate (54.2kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SEMA6D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
semaphorin-6D isoform 6
NCBI Official Synonym Full Names
semaphorin 6D
NCBI Official Symbol
SEMA6D
NCBI Protein Information
semaphorin-6D
UniProt Protein Name
Semaphorin-6D
Protein Family
UniProt Gene Name
SEMA6D
UniProt Synonym Gene Names
KIAA1479

NCBI Description

Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphorin domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. This gene encodes a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Several transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner. [provided by RefSeq, Nov 2010]

Uniprot Description

Shows growth cone collapsing activity on dorsal root ganglion (DRG) neurons in vitro. May be a stop signal for the DRG neurons in their target areas, and possibly also for other neurons. May also be involved in the maintenance and remodeling of neuronal connections.

Research Articles on SEMA6D

Similar Products

Product Notes

The SEMA6D sema6d (Catalog #AAA6393597) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Semaphorin 6D (Semaphorin-6D, SEMA6D, KIAA1479) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Semaphorin 6D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SEMA6D sema6d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Semaphorin 6D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.