Rabbit anti-Human, Mouse Semaphorin 6D Polyclonal Antibody | anti-SEMA6D antibody

Semaphorin 6D (Semaphorin-6D, SEMA6D, KIAA1479) (AP)

Cat. Num. AAA6393596

• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Semaphorin 6D; Polyclonal Antibody; Semaphorin 6D (Semaphorin-6D; SEMA6D; KIAA1479) (AP); anti-SEMA6D antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SEMA6D. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 476

• Applicable Applications for anti-SEMA6D antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human SEMA6D, aa1-476 (NP_079242.2).
• Immunogen Sequence: MRVFLLCAYILLLMVSQLRAVSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLYIAGRDQVYTVNLNEMPKTEVIPNKKLTWRSRQQDRENCAMKGKHKDECHNFIKVFVPRNDEMVFVCGTNAFNPMCRYYRLSTLEYDGEEISGLARCPFDARQTNVALFADGKLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGNYVYFFFREIAVEHNNLGKAVYSRVARICKNDMGGSQRVLEKHWTSFLKARLNCSVPGDSFFYFDVLQSITDIIQINGIPTVVGVFTTQLNSIPGSAVCAFSMDDIEKVFKGRFKEQKTPDSVWTAVPEDKVPKPRPGCCAKHGLAEAYKTSIDFPDETLSFIKSHPLMDSAVPPIADEPWFTKTRVRYRLTAISVDHSAGPYQNYTVIFVGSEAGMVLKVLAKTSPFSLNDSVLLEEIEAYNHAK
• Conjugate: AP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SEMA6D rabbit polyclonal antibody. Western Blot analysis of SEMA6D expression in mouse lung.)

Western Blot (WB)

(SEMA6D rabbit polyclonal antibody. Western Blot analysis of SEMA6D expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of SEMA6D expression in transfected 293T cell line by SEMA6D polyclonal antibody. Lane 1: SEMA6D transfected lysate (54.2kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-SEMA6D antibody

Antibodies; Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 24234732
• NCBI GeneID: 80031
• NCBI Accession #: NP_079242.2
• NCBI GenBank Nucleotide #: NM_024966.2
• UniProt Accession #: Q8NFY4
• NCBI Official Full Name: semaphorin-6D isoform 6
• NCBI Official Synonym Full Names: semaphorin 6D
• NCBI Official Symbol: SEMA6D
• NCBI Protein Information: semaphorin-6D
• UniProt Protein Name: Semaphorin-6D
• Protein Family: Semaphorin
• UniProt Gene Name: SEMA6D
• UniProt Synonym Gene Names: KIAA1479

NCBI Description

Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphorin domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. This gene encodes a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Several transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner. [provided by RefSeq, Nov 2010]

Uniprot Description

Shows growth cone collapsing activity on dorsal root ganglion (DRG) neurons in vitro. May be a stop signal for the DRG neurons in their target areas, and possibly also for other neurons. May also be involved in the maintenance and remodeling of neuronal connections.