Mouse anti-Human Semaphorin 6D Polyclonal Antibody | anti-Sema6d antibody

Semaphorin 6D (Semaphorin-6D, SEMA6D, KIAA1479)

Cat. Num. AAA648737

• Gene Names: Sema6d; AA409156; Sema6D-1; Sema6D-2; Sema6D-4; Sema6D-5; Sema6D-6; mKIAA1479; D330011G23; 1110067B02Rik
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: Semaphorin 6D; Polyclonal Antibody; Semaphorin 6D (Semaphorin-6D; SEMA6D; KIAA1479); Anti -Semaphorin 6D (Semaphorin-6D; anti-Sema6d antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SEMA6D.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MRVFLLCAYILLLMVSQLRAVSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLYIAGRDQVYTVNLNEMPKTEVIPNKKLTWRSRQQDRENCAMKGKHKDECHNFIKVFVPRNDEMVFVCGTNAFNPMCRYYRLSTLEYDGEEISGLARCPFDARQTNVALFADGKLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGNYVYFFFREIAVEHNNLGKAVYSRVARICKNDMGGSQRVLEKHWTSFLKARLNCSVPGDSFFYFDVLQSITDIIQINGIPTVVGVFTTQLNSIPGSAVCAFSMDDIEKVFKGRFKEQKTPDSVWTAVPEDKVPKPRPGCCAKHGLAEAYKTSIDFPDETLSFIKSHPLMDSAVPPIADEPWFTKTRVRYRLTAISVDHSAGPYQNYTVIFVGSEAGMVLKVLAKTSPFSLNDSVLLEEIEAYNHAK

• Applicable Applications for anti-Sema6d antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human SEMA6D, aa1-476 (NP_079242.2).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SEMA6D expression in transfected 293T cell line by SEMA6D polyclonal antibody. Lane1:SEMA6D transfected lysate (52.36kD). Lane2:Non-transfected lysate.)

Product Categories/Family for anti-Sema6d antibody

Antibodies; Abs to Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 40385879
• NCBI GeneID: 214968
• NCBI Accession #: NP_954711.1
• NCBI GenBank Nucleotide #: NM_199241.2
• UniProt Accession #: Q76KF0; Q76KF1; Q76KF2; Q76KF3; Q76KF4; Q80TD0; A2AW72
• Molecular Weight: 119,815 Da
• NCBI Official Full Name: semaphorin-6D isoform 4
• NCBI Official Synonym Full Names: sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6D
• NCBI Official Symbol: Sema6d
• NCBI Official Synonym Symbols: AA409156; Sema6D-1; Sema6D-2; Sema6D-4; Sema6D-5; Sema6D-6; mKIAA1479; D330011G23; 1110067B02Rik
• NCBI Protein Information: semaphorin-6D; semaphorin 6D
• UniProt Protein Name: Semaphorin-6D
• Protein Family: Semaphorin
• UniProt Gene Name: Sema6d
• UniProt Synonym Gene Names: Kiaa1479
• UniProt Entry Name: SEM6D_MOUSE

Uniprot Description

Function: Shows growth cone collapsing activity on dorsal root ganglion (DRG) neurons in vitro. May be a stop signal for the DRG neurons in their target areas, and possibly also for other neurons. May also be involved in the maintenance and remodeling of neuronal connections

By similarity.

Subcellular location: Cell membrane; Single-pass type I membrane protein

By similarity.

Tissue specificity: Expressed in brain and lung. Ref.1

Sequence similarities: Belongs to the semaphorin family.Contains 1 PSI domain.Contains 1 Sema domain.

Sequence caution: The sequence BAC65797.1 differs from that shown. Reason: Erroneous initiation.