Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse PTPRN Monoclonal Antibody | anti-PTPRN antibody

PTPRN (Protein Tyrosine Phosphatase, Receptor Type, N, FLJ16131, IA-2, IA-2/PTP, IA2, ICA512, R-PTP-N) (MaxLight 750)

Gene Names
PTPRN; IA2; IA-2; ICA512; R-PTP-N; IA-2/PTP
Applications
Western Blot
Purity
Purified
Synonyms
PTPRN; Monoclonal Antibody; PTPRN (Protein Tyrosine Phosphatase; Receptor Type; N; FLJ16131; IA-2; IA-2/PTP; IA2; ICA512; R-PTP-N) (MaxLight 750); Protein Tyrosine Phosphatase; R-PTP-N; anti-PTPRN antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8000
Specificity
Recognizes PTPRN.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Sequence Length
979
Applicable Applications for anti-PTPRN antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PTPRN (NP_002837, 205aa-311aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LLQPYLFHQFGSRDGSRVSEGSPGMVSVGPLPKAEAPALFSRTASKGIFGDHPGHSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEG
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PTPRN antibody
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single catalytic domain, and thus represents a receptor-type PTP. This PTP was found to be an autoantigen that is reactive with insulin-dependent diabetes mellitus (IDDM) patient sera, and thus may be a potential target of autoimmunity in diabetes mellitus. [provided by RefSeq]
Product Categories/Family for anti-PTPRN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
receptor-type tyrosine-protein phosphatase-like N isoform 1
NCBI Official Synonym Full Names
protein tyrosine phosphatase receptor type N
NCBI Official Symbol
PTPRN
NCBI Official Synonym Symbols
IA2; IA-2; ICA512; R-PTP-N; IA-2/PTP
NCBI Protein Information
receptor-type tyrosine-protein phosphatase-like N
UniProt Protein Name
Receptor-type tyrosine-protein phosphatase-like N
UniProt Gene Name
PTPRN
UniProt Synonym Gene Names
ICA3; ICA512; R-PTP-N; ICA 512
UniProt Entry Name
PTPRN_HUMAN

NCBI Description

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single catalytic domain, and thus represents a receptor-type PTP. This PTP was found to be an autoantigen that is reactive with insulin-dependent diabetes mellitus (IDDM) patient sera, and thus may be a potential target of autoimmunity in diabetes mellitus. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Dec 2010]

Uniprot Description

PTPRN: Implicated in neuroendocrine secretory processes. May be involved in processes specific for neurosecretory granules, such as their biogenesis, trafficking or regulated exocytosis or may have a general role in neuroendocrine functions. Seems to lack intrinsic enzyme activity. May play a role in the regulation of secretory granules via its interaction with SNTB2. Belongs to the protein-tyrosine phosphatase family. Receptor class 8 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor protein phosphatase, tyrosine; Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q35-q36.1

Cellular Component: integral to membrane

Molecular Function: GTPase binding; protein binding; spectrin binding; protein tyrosine phosphatase activity

Biological Process: response to reactive oxygen species; response to cAMP; response to estrogen stimulus; insulin secretion; cytokine and chemokine mediated signaling pathway; response to glucose stimulus; protein amino acid dephosphorylation; response to insulin stimulus

Research Articles on PTPRN

Similar Products

Product Notes

The PTPRN ptprn (Catalog #AAA6240181) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PTPRN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PTPRN ptprn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PTPRN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.