Mouse anti-Human FGGY Monoclonal Antibody | anti-FGGY antibody

FGGY (FLJ10986, FGGY Carbohydrate Kinase Domain-containing Protein) (HRP)

Cat. Num. AAA6152506

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FGGY; Monoclonal Antibody; FGGY (FLJ10986; FGGY Carbohydrate Kinase Domain-containing Protein) (HRP); anti-FGGY antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3B9
• Specificity: Recognizes human FLJ10986.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 551

• Applicable Applications for anti-FGGY antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 (NP_060761) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MWLDHRAVSQVNRINETKHSVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTYSAEKGWDDSFWKMIG
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(monoclonal antibody. Western Blot analysis of expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged FGGY is 1ng/ml as a capture antibody.)

Related Product Information for anti-FGGY antibody

Expressed in kidney, lung and small intestine and to a lower extent in liver and detected in cerebrospinal fluid (at protein level).

Product Categories/Family for anti-FGGY antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 164663828
• NCBI Accession #: NP_060761
• NCBI GenBank Nucleotide #: NM_018291
• UniProt Accession #: Q96C11
• NCBI Official Full Name: FGGY carbohydrate kinase domain-containing protein isoform b
• UniProt Protein Name: FGGY carbohydrate kinase domain-containing protein
• Protein Family: FGGY carbohydrate kinase domain-containing protein
• UniProt Gene Name: FGGY
• UniProt Entry Name: FGGY_HUMAN

Uniprot Description

FGGY: Defects in FGGY are associated with sporadic amyotrophic lateral sclerosis (ALS). Amyotrophic lateral sclerosis is a neurodegenerative disorder affecting upper and lower motor neurons and resulting in fatal paralysis. Sensory abnormalities are absent. Death usually occurs within 2 to 5 years. The etiology of amyotrophic lateral sclerosis is likely to be multifactorial, involving both genetic and environmental factors. Belongs to the FGGY kinase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, other; EC 2.7.1.-

Chromosomal Location of Human Ortholog: 1p32.1

Molecular Function: kinase activity; phosphotransferase activity, alcohol group as acceptor

Biological Process: carbohydrate metabolic process; phosphorylation