Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human AGO4 Monoclonal Antibody | anti-AGO4 antibody

AGO4 (Protein Argonaute-4, Argonaute4, hAgo4, Eukaryotic Translation Initiation Factor 2C 4, eIF-2C 4, eIF2C 4, EIF2C4, AGO4, KIAA1567) (MaxLight 750)

Gene Names
AGO4; EIF2C4
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AGO4; Monoclonal Antibody; AGO4 (Protein Argonaute-4; Argonaute4; hAgo4; Eukaryotic Translation Initiation Factor 2C 4; eIF-2C 4; eIF2C 4; EIF2C4; KIAA1567) (MaxLight 750); anti-AGO4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G3
Specificity
Recognizes human EIF2C4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-AGO4 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-101 from human EIF2C4 (NP_060099) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEALGPGPPASLFQPPRRPGLGTVGKPIRLLANHFQVQIPKIDVYHYDVDIKPEKRPRRVNREVVDTMVRHFKMQIFGDRQPGYDGKRNMYTAHPLPIGR
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-AGO4 antibody
AGO4 also known as EIF2C4 is involved in regulation of gene silencing via small RNA's such as siRNA and miRNA. This protein contains both a PAZ and a PIWI domain characteristic of Argonaute family of proteins. Functionally Ago4 is the catalytic component of the RNA-induced silencing complex (RISC). As part of this multi-protein complex, Ago4 interacts with miRNAs to help mediate translational repression of targeted messages.
Product Categories/Family for anti-AGO4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
97,097 Da
NCBI Official Full Name
protein argonaute-4
NCBI Official Synonym Full Names
argonaute 4, RISC catalytic component
NCBI Official Symbol
AGO4
NCBI Official Synonym Symbols
EIF2C4
NCBI Protein Information
protein argonaute-4
UniProt Protein Name
Protein argonaute-4
Protein Family
UniProt Gene Name
AGO4
UniProt Synonym Gene Names
EIF2C4; KIAA1567; Argonaute4; hAgo4; eIF-2C 4; eIF2C 4
UniProt Entry Name
AGO4_HUMAN

NCBI Description

This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and eukaryotic translation initiation factor 2C, 1. [provided by RefSeq, Jul 2008]

Uniprot Description

AGO4: Required for RNA-mediated gene silencing (RNAi). Binds to short RNAs such as microRNAs (miRNAs) and represses the translation of mRNAs which are complementary to them. Lacks endonuclease activity and does not appear to cleave target mRNAs. Also required for RNA-directed transcription and replication of the human hapatitis delta virus (HDV). Interacts with EIF4B, IMP8, PRMT5, TNRC6A and TNRC6B. Belongs to the argonaute family. Ago subfamily.

Protein type: Translation; Translation initiation

Chromosomal Location of Human Ortholog: 1p34

Cellular Component: cytoplasm; cytosol; membrane

Molecular Function: double-stranded RNA binding; miRNA binding; protein binding; single-stranded RNA binding

Biological Process: miRNA-mediated gene silencing, miRNA loading onto RISC; miRNA-mediated gene silencing, mRNA cleavage; miRNA-mediated gene silencing, negative regulation of translation; miRNA-mediated gene silencing, production of miRNAs; mRNA catabolic process; phosphoinositide-mediated signaling; pre-microRNA processing; RNA secondary structure unwinding; RNA-mediated posttranscriptional gene silencing; Wnt receptor signaling pathway, calcium modulating pathway

Research Articles on AGO4

Similar Products

Product Notes

The AGO4 ago4 (Catalog #AAA6231474) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AGO4 (Protein Argonaute-4, Argonaute4, hAgo4, Eukaryotic Translation Initiation Factor 2C 4, eIF-2C 4, eIF2C 4, EIF2C4, AGO4, KIAA1567) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AGO4 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AGO4 ago4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AGO4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.