Mouse anti-Human AGO4 Monoclonal Antibody | anti-AGO4 antibody

AGO4 (Protein Argonaute-4, Argonaute4, hAgo4, Eukaryotic Translation Initiation Factor 2C 4, eIF-2C 4, eIF2C 4, EIF2C4, AGO4, KIAA1567) (FITC)

Cat. Num. AAA6145820

• Gene Names: AGO4; EIF2C4
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AGO4; Monoclonal Antibody; AGO4 (Protein Argonaute-4; Argonaute4; hAgo4; Eukaryotic Translation Initiation Factor 2C 4; eIF-2C 4; eIF2C 4; EIF2C4; KIAA1567) (FITC); anti-AGO4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G3
• Specificity: Recognizes human EIF2C4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-AGO4 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa1-101 from human EIF2C4 (NP_060099) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MEALGPGPPASLFQPPRRPGLGTVGKPIRLLANHFQVQIPKIDVYHYDVDIKPEKRPRRVNREVVDTMVRHFKMQIFGDRQPGYDGKRNMYTAHPLPIGR
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged EIF2C4 is 3ng/ml as a capture antibody)

Related Product Information for anti-AGO4 antibody

AGO4 also known as EIF2C4 is involved in regulation of gene silencing via small RNA's such as siRNA and miRNA. This protein contains both a PAZ and a PIWI domain characteristic of Argonaute family of proteins. Functionally Ago4 is the catalytic component of the RNA-induced silencing complex (RISC). As part of this multi-protein complex, Ago4 interacts with miRNAs to help mediate translational repression of targeted messages.

Product Categories/Family for anti-AGO4 antibody

Antibodies; Translation Initiation Factors

NCBI and Uniprot Product Information

• NCBI GI #: 29029593
• NCBI GeneID: 192670
• NCBI Accession #: NP_060099.2
• NCBI GenBank Nucleotide #: NM_017629
• UniProt Accession #: Q9HCK5; A7MD27
• Molecular Weight: 97,097 Da
• NCBI Official Full Name: protein argonaute-4
• NCBI Official Synonym Full Names: argonaute 4, RISC catalytic component
• NCBI Official Symbol: AGO4
• NCBI Official Synonym Symbols: EIF2C4
• NCBI Protein Information: protein argonaute-4
• UniProt Protein Name: Protein argonaute-4
• Protein Family: Protein argonaute
• UniProt Gene Name: AGO4
• UniProt Synonym Gene Names: EIF2C4; KIAA1567; Argonaute4; hAgo4; eIF-2C 4; eIF2C 4
• UniProt Entry Name: AGO4_HUMAN

NCBI Description

This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and eukaryotic translation initiation factor 2C, 1. [provided by RefSeq, Jul 2008]

Uniprot Description

AGO4: Required for RNA-mediated gene silencing (RNAi). Binds to short RNAs such as microRNAs (miRNAs) and represses the translation of mRNAs which are complementary to them. Lacks endonuclease activity and does not appear to cleave target mRNAs. Also required for RNA-directed transcription and replication of the human hapatitis delta virus (HDV). Interacts with EIF4B, IMP8, PRMT5, TNRC6A and TNRC6B. Belongs to the argonaute family. Ago subfamily.

Protein type: Translation; Translation initiation

Chromosomal Location of Human Ortholog: 1p34

Cellular Component: cytoplasm; cytosol; membrane

Molecular Function: double-stranded RNA binding; miRNA binding; protein binding; single-stranded RNA binding

Biological Process: miRNA-mediated gene silencing, miRNA loading onto RISC; miRNA-mediated gene silencing, mRNA cleavage; miRNA-mediated gene silencing, negative regulation of translation; miRNA-mediated gene silencing, production of miRNAs; mRNA catabolic process; phosphoinositide-mediated signaling; pre-microRNA processing; RNA secondary structure unwinding; RNA-mediated posttranscriptional gene silencing; Wnt receptor signaling pathway, calcium modulating pathway