Mouse anti-Human AGO4 Monoclonal Antibody | anti-AGO4 antibody

AGO4 (Protein Argonaute-4, Argonaute4, hAgo4, Eukaryotic Translation Initiation Factor 2C 4, eIF-2C 4, eIF2C 4, EIF2C4, AGO4, KIAA1567)

Cat. Num. AAA6003258

• Gene Names: AGO4; ARGONAUTE 4; OCP11; OVEREXPRESSOR OF CATIONIC PEROXIDASE 11; T20P8.9; T20P8_9
• Reactivity: Human
• Applications: ELISA
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: AGO4; Monoclonal Antibody; AGO4 (Protein Argonaute-4; Argonaute4; hAgo4; Eukaryotic Translation Initiation Factor 2C 4; eIF-2C 4; eIF2C 4; EIF2C4; KIAA1567); Anti -AGO4 (Protein Argonaute-4; anti-AGO4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G3
• Specificity: Recognizes human EIF2C4.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MEALGPGPPASLFQPPRRPGLGTVGKPIRLLANHFQVQIPKIDVYHYDVDIKPEKRPRRVNREVVDTMVRHFKMQIFGDRQPGYDGKRNMYTAHPLPIGR

• Applicable Applications for anti-AGO4 antibody: ELISA (EL/EIA)
• Application Notes: Suitable for use in ELISA.
• Immunogen: Partial recombinant protein corresponding to aa1-101 from human EIF2C4 (NP_060099) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged EIF2C4 is 3ng/ml as a capture antibody)

Related Product Information for anti-AGO4 antibody

AGO4 also known as EIF2C4 is involved in regulation of gene silencing via small RNA's such as siRNA and miRNA. This protein contains both a PAZ and a PIWI domain characteristic of Argonaute family of proteins. Functionally Ago4 is the catalytic component of the RNA-induced silencing complex (RISC). As part of this multi-protein complex, Ago4 interacts with miRNAs to help mediate translational repression of targeted messages.

Product Categories/Family for anti-AGO4 antibody

Antibodies; Abs to Translation Initiation Factors

NCBI and Uniprot Product Information

• NCBI GI #: 334184499
• NCBI GeneID: 817246
• NCBI Accession #: NP_001189613.1
• NCBI GenBank Nucleotide #: NM_001202684.1
• UniProt Accession #: Q9ZVD5; Q93VG2
• Molecular Weight: 102,840 Da
• NCBI Official Full Name: argonaute 4
• NCBI Official Symbol: AGO4
• NCBI Official Synonym Symbols: ARGONAUTE 4; OCP11; OVEREXPRESSOR OF CATIONIC PEROXIDASE 11; T20P8.9; T20P8_9
• NCBI Protein Information: argonaute 4
• UniProt Protein Name: Protein argonaute 4
• Protein Family: Protein argonaute
• UniProt Gene Name: AGO4
• UniProt Synonym Gene Names: OCP11
• UniProt Entry Name: AGO4_ARATH

NCBI Description

AGO4 is a member of a class of PAZ/PIWI domain containing proteins involved in siRNA mediated gene silencing.Loss of function mutations have reduced site specific CpNpG and CpHpH methylation and increased susceptibility to bacterial pathogens.

Uniprot Description

Function: Involved in transcriptional gene silencing (TGS). Component of the RISC complex that associate with the small interfering RNA (siRNA) pathway involved in direct cytosine methylation at endogenous DNA repeats. Forms a AGO4/NRPE1/siRNA complex in cajal body, facilitating its function in RNA-directed gene silencing of target loci. Required for CpNpG and asymmetric DNA methylation as well as histone H3 'Lys-9' methylation (H3K9me) at SUP and SN1 loci. May be not required for CpG methylation. Required for the production and maintenance of retrotransposon SN1 and Copia and ribosomal 5S 25 nucleotide siRNAs specialized in gene silencing at chromatin level. Involved in de novo methylation of FWA gene and required for the maintenance of RNA-directed DNA methylation (RdDM) triggered by inverted repeat transgenes. Interacts with miRNA miR390 and miR172, targeting respectively TAS3 and AP2 mRNAs, and mediates cleavage of miRNA targets. Associates mainly with small RNAs of 24 nucleotide in length and preferentially recruits small RNAs with a 5' terminal adenosine. Targeted by the turnip yellows virus (TuYV) protein P0 (via F-box-like domain) for probable proteasome degradation and thereby inactivating AGO4 function in RNA silencing. Required for resistance to the bacterial pathogen P.syringae. Works independently of the RdDM pathway in mediating resistance to P.syringae. RdDM is involved in viral genome methylation as an epigenetic defense against geminiviruses. Ref.4 Ref.5 Ref.6 Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 Ref.14 Ref.16 Ref.18

Subunit structure: Interacts with NRPE1 (via C-terminus). Binding to NRPE1 is required for its function in RdDM. Interacts with turnip crinkle virus (TCV) capsid protein P38; this interaction inhibits probably RNA silencing ability of AGO4. Interacts with SDE3. Ref.8 Ref.11 Ref.16 Ref.17 Ref.19

Subcellular location: Nucleus › nucleolus. Nucleus › Cajal body. Note: Also located in AB-bodies that are distincts from the Cajal bodies and immediately adjacent to the condensed 45S ribosomal DNA (rDNA) loci. Ref.7 Ref.8 Ref.15

Tissue specificity: Expressed in embryos, mature leaves, vascular tissue of the sepals, stamens and stigma, at the tip of the style and siliques. Ref.18

Disruption phenotype: Decreased DNA cytosine methylation at CpNpG and asymmetric positions at different DNA loci corresponding to retroelements, transposons and repetitive DNA sequences. Ref.4 Ref.12

Sequence similarities: Belongs to the argonaute family. Ago subfamily.Contains 1 PAZ domain.Contains 1 Piwi domain.