Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human DES Monoclonal Antibody | anti-DES antibody

DES (Desmin) (MaxLight 650)

Gene Names
DES; CSM1; CSM2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DES; Monoclonal Antibody; DES (Desmin) (MaxLight 650); anti-DES antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D12
Specificity
Recognizes human DES.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-DES antibody
FLISA, Western Blot (WB)
Application Notes
Sandwich FLISA: The detection limit is ~0.1ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa361-470 from human DES (NP_001918) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-DES antibody
References
1. Fluorophore-labeled nanocapsules displaying IgG Fc-binding domains for the simultaneous detection of multiple antigens. Iijima M, Matsuzaki T, Yoshimoto N, Niimi T, Tanizawa K, Kuroda S.Biomaterials. 2011 Aug 23.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
53,536 Da
NCBI Official Full Name
desmin
NCBI Official Synonym Full Names
desmin
NCBI Official Symbol
DES
NCBI Official Synonym Symbols
CSM1; CSM2
NCBI Protein Information
desmin; intermediate filament protein
UniProt Protein Name
Desmin
Protein Family
UniProt Gene Name
DES
UniProt Entry Name
DESM_HUMAN

NCBI Description

This gene encodes a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in this gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies. [provided by RefSeq, Jul 2008]

Uniprot Description

desmin: a class-III intermediate filaments found in muscle cells. In adult striated muscle they form a fibrous network connecting myofibrils to each other and to the plasma membrane from the periphery of the Z-line structures. Mutations in this gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.

Protein type: Motility/polarity/chemotaxis; Cytoskeletal

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: intermediate filament; fascia adherens; Z disc; cytosol; neuromuscular junction; sarcolemma

Molecular Function: identical protein binding; protein binding; structural constituent of cytoskeleton; cytoskeletal protein binding

Biological Process: muscle contraction; cytoskeleton organization and biogenesis; regulation of heart contraction; muscle filament sliding

Disease: Cardiomyopathy, Dilated, 1i; Scapuloperoneal Syndrome, Neurogenic, Kaeser Type; Myopathy, Myofibrillar, 1; Muscular Dystrophy, Limb-girdle, Type 2r

Research Articles on DES

Similar Products

Product Notes

The DES des (Catalog #AAA6221803) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DES (Desmin) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DES can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Sandwich FLISA: The detection limit is ~0.1ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DES des for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DES, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.