Mouse ATP6V1G2 Monoclonal Antibody | anti-ATP6V1G2 antibody

ATP6V1G2 (V-type Proton ATPase Subunit G 2, V-ATPase Subunit G 2, V-ATPase 13 kDa Subunit 2, Vacuolar Proton Pump Subunit G 2, ATP6G, ATP6G2, NG38)

Cat. Num. AAA6003186

• Gene Names: ATP6V1G2; NG38; ATP6G; VMA10; ATP6G2
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ATP6V1G2; Monoclonal Antibody; ATP6V1G2 (V-type Proton ATPase Subunit G 2; V-ATPase Subunit G 2; V-ATPase 13 kDa Subunit 2; Vacuolar Proton Pump Subunit G 2; ATP6G; ATP6G2; NG38); Anti -ATP6V1G2 (V-type Proton ATPase Subunit G 2; anti-ATP6V1G2 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2b Lambda
• Clone Number: 2E11
• Specificity: Recognizes human ATP6V1G2. Species Crossreactivity: mouse and rat.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: QMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA

• Applicable Applications for anti-ATP6V1G2 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa41-118 from human ATP6V1G2 (NP_569730) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.32kD).)

Western Blot (WB)

(ATP6V1G2 monoclonal antibody. Western Blot analysis of ATP6V1G2 expression in PC-12.)

Western Blot (WB)

(ATP6V1G2 monoclonal antibody, Western Blot analysis of ATP6V1G2 expression in HepG2.)

Western Blot (WB)

(ATP6V1G2 monoclonal antibody Western Blot analysis of ATP6V1G2 expression in Raw 264.7.)

Western Blot (WB)

(ATP6V1G2 monoclonal antibody Western Blot analysis of ATP6V1G2 expression in NIH/3T3.)

Western Blot (WB)

(Western Blot analysis of ATP6V1G2 expression in transfected 293T cell line by ATP6V1G2 monoclonal antibody.|Lane 1: ATP6V1G2 transfected lysate (13.6kD).|Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-ATP6V1G2 antibody

Antibodies; Abs to Enzymes; ATPase

NCBI and Uniprot Product Information

• NCBI GI #: 45751557
• NCBI GeneID: 534
• UniProt Accession #: O95670; Q2L6F8; Q5HYU8; Q5RJ63; B5MEF0
• Molecular Weight: 13,604 Da
• NCBI Official Full Name: ATP6V1G2 protein, partial
• NCBI Official Synonym Full Names: ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2
• NCBI Official Symbol: ATP6V1G2
• NCBI Official Synonym Symbols: NG38; ATP6G; VMA10; ATP6G2
• NCBI Protein Information: V-type proton ATPase subunit G 2; V-ATPase 13 kDa subunit 2; vacuolar proton pump G subunit 2; vacuolar ATP synthase subunit G 2; H(+)-transporting two-sector ATPase, subunit G2; ATPase, H+ transporting, lysosomal (vacuolar proton pump)
• UniProt Protein Name: V-type proton ATPase subunit G 2
• UniProt Gene Name: ATP6V1G2
• UniProt Synonym Gene Names: ATP6G; ATP6G2; NG38; V-ATPase subunit G 2
• UniProt Entry Name: VATG2_HUMAN

NCBI Description

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of three V1 domain G subunit proteins. This gene had previous gene symbols of ATP6G and ATP6G2. Alternatively spliced transcript variants encoding different isoforms have been described. Read-through transcription also exists between this gene and the downstream DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B (DDX39B) gene. [provided by RefSeq, Feb 2011]

Uniprot Description

ATP6V1G2: Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. Belongs to the V-ATPase G subunit family.

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: melanosome; vacuolar proton-transporting V-type ATPase complex; cytosol; integral to synaptic vesicle membrane

Molecular Function: hydrogen-exporting ATPase activity, phosphorylative mechanism

Biological Process: interaction with host; metabolic process; cellular iron ion homeostasis; insulin receptor signaling pathway; transferrin transport; transmembrane transport