Mouse anti-Human DES Monoclonal Antibody | anti-DES antibody

DES (Desmin) APC

Cat. Num. AAA6136218

• Gene Names: DES; CSM1; CSM2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DES; Monoclonal Antibody; DES (Desmin) APC; anti-DES antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1D12
• Specificity: Recognizes human DES.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-DES antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa361-470 from human DES (NP_001918) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Testing Data

(Detection limit for recombinant GST tagged DES is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-DES antibody

Antibodies; Extracellular Matrix Proteins

References

1. Fluorophore-labeled nanocapsules displaying IgG Fc-binding domains for the simultaneous detection of multiple antigens. Iijima M, Matsuzaki T, Yoshimoto N, Niimi T, Tanizawa K, Kuroda S.Biomaterials. 2011 Aug 23.

NCBI and Uniprot Product Information

• NCBI GI #: 55749932
• NCBI GeneID: 1674
• NCBI Accession #: NP_001918.3
• NCBI GenBank Nucleotide #: NM_001927
• UniProt Accession #: P17661; Q15787; Q549R7; Q549R8; Q549R9; Q8IZR1; Q8IZR6; Q8NES2; Q8NEU6; Q8TAC4; Q8TCX2; Q8TD99
• Molecular Weight: 53,536 Da
• NCBI Official Full Name: desmin
• NCBI Official Synonym Full Names: desmin
• NCBI Official Symbol: DES
• NCBI Official Synonym Symbols: CSM1; CSM2
• NCBI Protein Information: desmin; intermediate filament protein
• UniProt Protein Name: Desmin
• Protein Family: Desmin
• UniProt Gene Name: DES
• UniProt Entry Name: DESM_HUMAN

NCBI Description

This gene encodes a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in this gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies. [provided by RefSeq, Jul 2008]

Uniprot Description

desmin: a class-III intermediate filaments found in muscle cells. In adult striated muscle they form a fibrous network connecting myofibrils to each other and to the plasma membrane from the periphery of the Z-line structures. Mutations in this gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.

Protein type: Motility/polarity/chemotaxis; Cytoskeletal

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: intermediate filament; fascia adherens; Z disc; cytosol; neuromuscular junction; sarcolemma

Molecular Function: identical protein binding; protein binding; structural constituent of cytoskeleton; cytoskeletal protein binding

Biological Process: muscle contraction; cytoskeleton organization and biogenesis; regulation of heart contraction; muscle filament sliding

Disease: Cardiomyopathy, Dilated, 1i; Scapuloperoneal Syndrome, Neurogenic, Kaeser Type; Myopathy, Myofibrillar, 1; Muscular Dystrophy, Limb-girdle, Type 2r