Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SNRPG Monoclonal Antibody | anti-SNRPG antibody

SNRPG (Small Nuclear Ribonucleoprotein G, snRNP-G, Sm Protein G, Sm-G, SmG, PBSCG, MGC117317) (MaxLight 550)

Gene Names
SNRPG; SMG; Sm-G
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SNRPG; Monoclonal Antibody; SNRPG (Small Nuclear Ribonucleoprotein G; snRNP-G; Sm Protein G; Sm-G; SmG; PBSCG; MGC117317) (MaxLight 550); anti-SNRPG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2H8-1C12
Specificity
Recognizes human SNRPG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-SNRPG antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-77 from human SNRPG (AAH00070) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV*
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SNRPG antibody
Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5.Component of the heptameric ring U7 snRNP complex, or U7 Sm protein core complex, at least composed of LSM10, LSM11, SNRPB, SNRPD3, SNRPE, SNRPF, SNRPG and U7 snRNA. Formation of the U7 snRNP is an ATP-dependent process mediated by a specialized SMN complex containing at least the Sm protein core complex and additionally, the U7-specific LSM10 and LSM11 proteins. Identified in the spliceosome C complex. Component of the U11/U12 snRNPs that are part of the U12-type spliceosome. Interacts with TACC1.
Product Categories/Family for anti-SNRPG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
8,496 Da
NCBI Official Full Name
Homo sapiens small nuclear ribonucleoprotein polypeptide G, mRNA
NCBI Official Synonym Full Names
small nuclear ribonucleoprotein polypeptide G
NCBI Official Symbol
SNRPG
NCBI Official Synonym Symbols
SMG; Sm-G
NCBI Protein Information
small nuclear ribonucleoprotein G
UniProt Protein Name
Small nuclear ribonucleoprotein G
UniProt Gene Name
SNRPG
UniProt Synonym Gene Names
PBSCG; snRNP-G; Sm-G; SmG
UniProt Entry Name
RUXG_HUMAN

NCBI Description

The protein encoded by this gene is a component of the U1, U2, U4, and U5 small nuclear ribonucleoprotein complexes, precursors of the spliceosome. The encoded protein may also be a part of the U7 small nuclear ribonucleoprotein complex, which participates in the processing of the 3' end of histone transcripts. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]

Uniprot Description

snRNP G: Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5. Belongs to the snRNP Sm proteins family.

Protein type: RNA splicing; Spliceosome; RNA-binding

Chromosomal Location of Human Ortholog: 2p13.3

Cellular Component: nucleoplasm; small nuclear ribonucleoprotein complex; spliceosome; snRNP U1; cytosol; U12-dependent spliceosome

Molecular Function: protein binding

Biological Process: nuclear mRNA splicing, via spliceosome; transcription from RNA polymerase II promoter; spliceosomal snRNP biogenesis; RNA splicing; histone mRNA metabolic process; spliceosome assembly; gene expression; mRNA 3'-end processing; termination of RNA polymerase II transcription

Similar Products

Product Notes

The SNRPG snrpg (Catalog #AAA6214112) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SNRPG (Small Nuclear Ribonucleoprotein G, snRNP-G, Sm Protein G, Sm-G, SmG, PBSCG, MGC117317) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNRPG can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SNRPG snrpg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SNRPG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.