Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Small nuclear ribonucleoprotein G Recombinant Protein | SNRPG recombinant protein

Recombinant Human Small nuclear ribonucleoprotein G

Gene Names
SNRPG; SMG; Sm-G
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Small nuclear ribonucleoprotein G; Recombinant Human Small nuclear ribonucleoprotein G; Sm protein G; Sm-G; SmG; SNRPG recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-76
Sequence
MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV
Sequence Length
76
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

SDS-Page
Related Product Information for SNRPG recombinant protein
Core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assble in an heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing.
Product Categories/Family for SNRPG recombinant protein
References
snRNP Sm proteins share two evolutionarily conserved sequence motifs which are involved in Sm protein-protein interactions.Hermann H., Fabrizio P., Raker V.A., Foulaki K., Hornig H., Brahms H., Luehrmann R.EMBO J. 14:2076-2088(1995)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35.9kD
NCBI Official Full Name
small nuclear ribonucleoprotein G isoform a
NCBI Official Synonym Full Names
small nuclear ribonucleoprotein polypeptide G
NCBI Official Symbol
SNRPG
NCBI Official Synonym Symbols
SMG; Sm-G
NCBI Protein Information
small nuclear ribonucleoprotein G
UniProt Protein Name
Small nuclear ribonucleoprotein G
UniProt Gene Name
SNRPG
UniProt Synonym Gene Names
PBSCG; snRNP-G; Sm-G; SmG
UniProt Entry Name
RUXG_HUMAN

NCBI Description

The protein encoded by this gene is a component of the U1, U2, U4, and U5 small nuclear ribonucleoprotein complexes, precursors of the spliceosome. The encoded protein may also be a part of the U7 small nuclear ribonucleoprotein complex, which participates in the processing of the 3' end of histone transcripts. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]

Uniprot Description

snRNP G: Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5. Belongs to the snRNP Sm proteins family.

Protein type: Spliceosome; RNA-binding; RNA splicing

Chromosomal Location of Human Ortholog: 2p13.3

Cellular Component: cytosol; nucleoplasm; small nuclear ribonucleoprotein complex; small nucleolar ribonucleoprotein complex; snRNP U1; snRNP U2; snRNP U5; spliceosome; U12-dependent spliceosome

Molecular Function: protein binding; RNA binding

Biological Process: gene expression; histone mRNA metabolic process; mRNA 3'-end processing; nuclear mRNA splicing, via spliceosome; RNA splicing; spliceosomal snRNP biogenesis; spliceosome assembly; termination of RNA polymerase II transcription; transcription from RNA polymerase II promoter

Similar Products

Product Notes

The SNRPG snrpg (Catalog #AAA717187) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-76. The amino acid sequence is listed below: MSKAHPPELK KFMDKKLSLK LNGGRHVQGI LRGFDPFMNL VIDECVEMAT SGQQNNIGMV VIRGNSIIML EALERV. It is sometimes possible for the material contained within the vial of "Small nuclear ribonucleoprotein G, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.