Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ROR2 Monoclonal Antibody | anti-ROR2 antibody

ROR2 (Tyrosine-protein Kinase Transmembrane Receptor ROR2, Neurotrophic Tyrosine Kinase, Receptor-related 2, NTRKR2, MGC163394) (MaxLight 405)

Gene Names
ROR2; BDB; BDB1; NTRKR2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ROR2; Monoclonal Antibody; ROR2 (Tyrosine-protein Kinase Transmembrane Receptor ROR2; Neurotrophic Tyrosine Kinase; Receptor-related 2; NTRKR2; MGC163394) (MaxLight 405); anti-ROR2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E1
Specificity
Recognizes human ROR2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-ROR2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa34-144 from human ROR2 (NP_004551) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGMKT
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ROR2 antibody
ROR2 is a tyrosine-protein kinase receptor which may be involved in the early formation of the chondrocytes. It seems to be required for cartilage and growth plate development. This Type I membrane protein is expressed at high levels during early embryonic development. The expression levels drop strongly around day 16 and there are only very low levels in adult tissues. Defects in ROR2 are a cause of brachydactyly type B1 (BDB1). BDB1 is an autosomal dominant skeletal disorder characterized by hypoplasia/aplasia of distal phalanges and nails. In BDB1 the middle phalanges are short but in addition the terminal phalanges are rudimentary or absent. Both fingers and toes are affected. The thumbs and big toes are usually deformed. Defects in ROR2 are a cause of recessive Robinow syndrome (RRS). RRS is an autosomal disorder characterized by skeletal dysplasia with generalized limb bone shortening, segmental defects of the spine, brachydactyly and a dysmorphic facial appearance. The protein contains 1 frizzled (FZ) domain, 1 immunoglobulin-like C2-type domain, and 1 kringle domain.
Product Categories/Family for anti-ROR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
104,757 Da
NCBI Official Full Name
tyrosine-protein kinase transmembrane receptor ROR2
NCBI Official Synonym Full Names
receptor tyrosine kinase-like orphan receptor 2
NCBI Official Symbol
ROR2
NCBI Official Synonym Symbols
BDB; BDB1; NTRKR2
NCBI Protein Information
tyrosine-protein kinase transmembrane receptor ROR2; neurotrophic tyrosine kinase receptor-related 2
UniProt Protein Name
Tyrosine-protein kinase transmembrane receptor ROR2
UniProt Gene Name
ROR2
UniProt Synonym Gene Names
NTRKR2
UniProt Entry Name
ROR2_HUMAN

Uniprot Description

ROR2: a receptor tyrosine kinase of the ROR family. May be involved in the early formation of the chondrocytes and may be required for cartilage and growth plate development. Mutations can cause brachydactyly type B, a skeletal disorder characterized by hypoplasia/aplasia of distal phalanges and nails. In addition, mutations in this gene can cause the autosomal recessive form of Robinow syndrome, which is characterized by skeletal dysplasia with generalized limb bone shortening, segmental defects of the spine, brachydactyly, and a dysmorphic facial appearance.

Protein type: Protein kinase, TK; Membrane protein, integral; Kinase, protein; Protein kinase, tyrosine (receptor); EC 2.7.10.1; TK group; Ror family

Chromosomal Location of Human Ortholog: 9q22

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: Wnt-protein binding; protein binding; frizzled binding; transmembrane receptor protein tyrosine kinase activity; ATP binding

Biological Process: somitogenesis; inner ear morphogenesis; peptidyl-tyrosine phosphorylation; Wnt receptor signaling pathway, planar cell polarity pathway; multicellular organismal development; positive regulation of transcription, DNA-dependent; signal transduction; negative regulation of cell proliferation; Wnt receptor signaling pathway, calcium modulating pathway; JNK cascade; cell differentiation; transmembrane receptor protein tyrosine kinase signaling pathway; cartilage condensation; embryonic genitalia morphogenesis; positive regulation of cell migration

Disease: Robinow Syndrome, Autosomal Recessive; Brachydactyly, Type B1

Similar Products

Product Notes

The ROR2 ror2 (Catalog #AAA6192362) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ROR2 (Tyrosine-protein Kinase Transmembrane Receptor ROR2, Neurotrophic Tyrosine Kinase, Receptor-related 2, NTRKR2, MGC163394) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ROR2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ROR2 ror2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ROR2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.