Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RAC1Sample Type: U937 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human RAC1 Polyclonal Antibody | anti-RAC1 antibody

RAC1 Antibody - middle region

Gene Names
RAC1; MIG5; MRD48; Rac-1; TC-25; p21-Rac1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RAC1; Polyclonal Antibody; RAC1 Antibody - middle region; anti-RAC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIG
Sequence Length
192
Applicable Applications for anti-RAC1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human RAC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RAC1Sample Type: U937 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RAC1Sample Type: U937 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RAC1 antibody
This is a rabbit polyclonal antibody against RAC1. It was validated on Western Blot

Target Description: The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-RAC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
Ras-related C3 botulinum toxin substrate 1
NCBI Official Synonym Full Names
Rac family small GTPase 1
NCBI Official Symbol
RAC1
NCBI Official Synonym Symbols
MIG5; MRD48; Rac-1; TC-25; p21-Rac1
NCBI Protein Information
ras-related C3 botulinum toxin substrate 1
UniProt Protein Name
Ras-related C3 botulinum toxin substrate 1
Protein Family
UniProt Gene Name
RAC1
UniProt Synonym Gene Names
TC25
UniProt Entry Name
RAC1_HUMAN

NCBI Description

The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]

Uniprot Description

RAC1: a plasma membrane-associated member of the Rho-GTPase family. Plays a key role in cytoskeletal reorganization, membrane trafficking, transcriptional regulation and cell growth and development. GTP binding stimulates its activity. Phosphorylation by Akt may inhibit GTP binding of Rac1, therefore attenuating the downstream signal transduction pathway. Found in a trimeric complex composed of DOCK1 and ELMO1, which plays a central role in phagocytosis of apoptotic cells. Two alternatively spliced isoforms have been described.

Protein type: Motility/polarity/chemotaxis; G protein; G protein, monomeric, Rho; G protein, monomeric

Chromosomal Location of Human Ortholog: 7p22

Cellular Component: extrinsic to plasma membrane; Golgi membrane; focal adhesion; membrane; lamellipodium; cytoplasm; plasma membrane; melanosome; actin filament; trans-Golgi network; cytosol; phagocytic cup

Molecular Function: GTPase activity; protein binding; enzyme binding; GTP binding; GTP-dependent protein binding; Rho GDP-dissociation inhibitor binding; thioesterase binding; protein kinase binding; Rab GTPase binding

Biological Process: viral reproduction; nerve growth factor receptor signaling pathway; metabolic process; positive regulation of apoptosis; cell motility involved in cell locomotion; regulation of cell migration; small GTPase mediated signal transduction; positive regulation of stress fiber formation; cell adhesion; bone resorption; platelet activation; anatomical structure morphogenesis; mast cell chemotaxis; dendrite morphogenesis; positive regulation of Rho protein signal transduction; regulation of defense response to virus by virus; negative regulation of interleukin-23 production; T cell costimulation; cerebral cortex radially oriented cell migration; actin cytoskeleton organization and biogenesis; axon guidance; cell-matrix adhesion; localization within membrane; positive regulation of focal adhesion formation; actin filament polymerization; response to wounding; ephrin receptor signaling pathway; inflammatory response; regulation of hydrogen peroxide metabolic process; lamellipodium biogenesis; embryonic olfactory bulb interneuron precursor migration; intercellular junction assembly and maintenance; Wnt receptor signaling pathway, planar cell polarity pathway; positive regulation of phosphoinositide 3-kinase activity; engulfment of apoptotic cell; cell proliferation; G-protein coupled receptor protein signaling pathway; hyperosmotic response; positive regulation of actin filament polymerization; organization of an anatomical structure; auditory receptor cell morphogenesis; ruffle organization and biogenesis; innate immune response; negative regulation of receptor-mediated endocytosis; positive regulation of protein amino acid phosphorylation; vascular endothelial growth factor receptor signaling pathway; blood coagulation; cell motility; positive regulation of DNA replication

Research Articles on RAC1

Similar Products

Product Notes

The RAC1 rac1 (Catalog #AAA3216138) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAC1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAC1 rac1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VRHHCPNTPI ILVGTKLDLR DDKDTIEKLK EKKLTPITYP QGLAMAKEIG. It is sometimes possible for the material contained within the vial of "RAC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.