Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse ASCL3 Monoclonal Antibody | anti-ASCL3 antibody

ASCL3 (Achaete-scute Complex Homolog 3 (Drosophila), HASH3, SGN1, bHLHa42) (AP)

Gene Names
ASCL3; SGN1; HASH3; bHLHa42
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
ASCL3; Monoclonal Antibody; ASCL3 (Achaete-scute Complex Homolog 3 (Drosophila); HASH3; SGN1; bHLHa42) (AP); Achaete-scute Complex Homolog 3 (Drosophila); bHLHa42; anti-ASCL3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F8
Specificity
Recognizes ASCL3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ASCL3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ASCL3 (NP_065697.1, 1aa-95aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MMDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEPCPFSFPMPYPNYRGCEYSYGPAFT
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ASCL3 antibody
Basic helix-loop-helix transcription factors, such as ASCL3, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]). [supplied by OMIM]
Product Categories/Family for anti-ASCL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,797 Da
NCBI Official Full Name
achaete-scute homolog 3
NCBI Official Synonym Full Names
achaete-scute family bHLH transcription factor 3
NCBI Official Symbol
ASCL3
NCBI Official Synonym Symbols
SGN1; HASH3; bHLHa42
NCBI Protein Information
achaete-scute homolog 3; achaete-scute complex homolog 3; bHLH transcriptional regulator Sgn-1; class A basic helix-loop-helix protein 42; bHLH transcription factor Sgn-1 (Salivary Glands 1)
UniProt Protein Name
Achaete-scute homolog 3
Protein Family
UniProt Gene Name
ASCL3
UniProt Synonym Gene Names
BHLHA42; HASH3; SGN1; ASH-3; hASH3; bHLHa42
UniProt Entry Name
ASCL3_HUMAN

NCBI Description

Basic helix-loop-helix transcription factors, such as ASCL3, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]).[supplied by OMIM, Mar 2008]

Uniprot Description

ASCL3: Transcriptional repressor. Inhibits myogenesis.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 11p15.3

Cellular Component: transcription factor complex; nucleus

Molecular Function: protein dimerization activity; DNA binding

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent

Similar Products

Product Notes

The ASCL3 ascl3 (Catalog #AAA6165801) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ASCL3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ASCL3 ascl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ASCL3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.