Mouse anti-Human ARVCF Monoclonal Antibody | anti-ARVCF antibody

ARVCF (Armadillo Repeat Protein Deleted in Velo-cardio-facial Syndrome) (PE)

Cat. Num. AAA6156595

• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ARVCF; Monoclonal Antibody; ARVCF (Armadillo Repeat Protein Deleted in Velo-cardio-facial Syndrome) (PE); anti-ARVCF antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5D2
• Specificity: Recognizes human ARVCF.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-ARVCF antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa863-962 from human ARVCF (NP_001661) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDALGPDGYSTVDRRERRPRGASSAGEASEKEPLKLDPSRKAPPPGPSRPAVRLVDAVGDAKPQPVDSWV
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(ARVCF monoclonal antibody Western Blot analysis of ARVCF expression in A-431.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ARVCF on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml].)

Product Categories/Family for anti-ARVCF antibody

Antibodies; Proteins

References

1. Xenopus Kazrin interacts with ARVCF-catenin, spectrin and p190B RhoGAP, and modulates RhoA activity and epithelial integrity. Cho K, Vaught TG, Ji H, Gu D, Papasakelariou-Yared C, Horstmann N, Jennings JM, Lee M, Sevilla LM, Kloc M, Reynolds AB, Watt FM, Brennan RG, Kowalczyk AP, McCrea PD.J Cell Sci. 2010 Dec 1;123(Pt 23):4128-44. Epub 2010 Nov 9.

NCBI and Uniprot Product Information

• NCBI GI #: 4502247
• NCBI GeneID: 421
• NCBI Accession #: NP_001661
• NCBI GenBank Nucleotide #: NM_001670
• UniProt Accession #: O00192
• Molecular Weight: 105kDa
• NCBI Official Full Name: armadillo repeat protein deleted in velo-cardio-facial syndrome
• NCBI Official Synonym Full Names: ARVCF delta catenin family member
• NCBI Official Symbol: ARVCF
• NCBI Protein Information: armadillo repeat protein deleted in velo-cardio-facial syndrome
• UniProt Protein Name: Armadillo repeat protein deleted in velo-cardio-facial syndrome
• Protein Family: Armadillo repeat protein deleted in velo-cardio-facial syndrome
• UniProt Gene Name: ARVCF
• UniProt Entry Name: ARVC_HUMAN

NCBI Description

Armadillo Repeat gene deleted in Velo-Cardio-Facial syndrome (ARVCF) is a member of the catenin family. This family plays an important role in the formation of adherens junction complexes, which are thought to facilitate communication between the inside and outside environments of a cell. The ARVCF gene was isolated in the search for the genetic defect responsible for the autosomal dominant Velo-Cardio-Facial syndrome (VCFS), a relatively common human disorder with phenotypic features including cleft palate, conotruncal heart defects and facial dysmorphology. The ARVCF gene encodes a protein containing two motifs, a coiled coil domain in the N-terminus and a 10 armadillo repeat sequence in the midregion. Since these sequences can facilitate protein-protein interactions ARVCF is thought to function in a protein complex. In addition, ARVCF contains a predicted nuclear-targeting sequence suggesting that it may have a function as a nuclear protein. [provided by RefSeq, Jun 2010]

Uniprot Description

ARVCF: Involved in protein-protein interactions at adherens junctions. Belongs to the beta-catenin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: nucleoplasm; cytoplasm; plasma membrane; intracellular; cell junction

Molecular Function: protein binding

Biological Process: cell-cell adhesion; multicellular organismal development; calcium-dependent cell-cell adhesion; cell adhesion

Disease: Velocardiofacial Syndrome