Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ST14 is ~1ng/ml as a capture antibody.)

Mouse anti-Human Matriptase Monoclonal Antibody | anti-MTSP1 antibody

Matriptase (ST14, Suppressor Of Tumorigenicity 14 Protein, Membrane-type Serine Protease 1, Serine Protease 14, Serine Protease TADG-15, Tumor-associated Differentially-expressed Gene 15 Protein, SNC19, Epitin, Prostamin, TADG15, MT-SP1, MTSP1, PRSS14) (P

Gene Names
ST14; HAI; MTSP1; SNC19; ARCI11; MT-SP1; PRSS14; TADG15; TMPRSS14
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Matriptase; Monoclonal Antibody; Matriptase (ST14; Suppressor Of Tumorigenicity 14 Protein; Membrane-type Serine Protease 1; Serine Protease 14; Serine Protease TADG-15; Tumor-associated Differentially-expressed Gene 15 Protein; SNC19; Epitin; Prostamin; TADG15; MT-SP1; MTSP1; PRSS14) (P; anti-MTSP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F4
Specificity
Recognizes human ST14.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-MTSP1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa298-401 from human ST14 (NP_068813) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PPSYNLTFHSSQNVLLITLITNTERRHPGFEATFFQLPRMSSCGGRLRKAQGTFNSPYYPGHYPPNIDCTWNIEVPNNQHVKVRFKFFYLLEPGVPAGTCPKD*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ST14 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ST14 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-MTSP1 antibody
Matriptase or MT-SP1 is an epithelial-derived type II transmembrane serine protease that is highly expressd in human cancer-derived cell lines. Matriptase cleaves and activates protease activated receptor-2, pro-urokinase plasminogen activator and pro-hepatocyte growth factor. Matriptase is strongly inhibited by the hepatocyte growth factor activator inhibitor type 1 (HAI-1), which is a reactive site loop of Kunitz domain and also a transmembrane serine protease inhibitor.
Product Categories/Family for anti-MTSP1 antibody
References
1. Novel surface targets and serum biomarkers from the ovarian cancer vasculature. Sasaroli D, Gimotty PA, Pathak HB, Hammond R, Kougioumtzidou E, Katsaros D, Buckanovich R, Devarajan K, Sandaltzopoulos R, Godwin AK, Scholler N, Coukos G.Cancer Biol Ther. 2011 Aug 1;12(3):169-80. Epub 2011 Aug 1.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94,770 Da
NCBI Official Full Name
suppressor of tumorigenicity 14 protein
NCBI Official Synonym Full Names
suppression of tumorigenicity 14 (colon carcinoma)
NCBI Official Symbol
ST14
NCBI Official Synonym Symbols
HAI; MTSP1; SNC19; ARCI11; MT-SP1; PRSS14; TADG15; TMPRSS14
NCBI Protein Information
suppressor of tumorigenicity 14 protein; membrane-type serine protease 1; prostamin; serine protease 14; serine protease TADG-15; suppression of tumorigenicity 14 (colon carcinoma, matriptase, epithin); tumor associated differentially expressed gene 15 pr
UniProt Protein Name
Suppressor of tumorigenicity 14 protein
UniProt Gene Name
ST14
UniProt Synonym Gene Names
PRSS14; SNC19; TADG15; MT-SP1
UniProt Entry Name
ST14_HUMAN

Uniprot Description

ST14: Degrades extracellular matrix. Proposed to play a role in breast cancer invasion and metastasis. Exhibits trypsin-like activity as defined by cleavage of synthetic substrates with Arg or Lys as the P1 site. Defects in ST14 are a cause of ichthyosis autosomal recessive with hypotrichosis (ARIH). ARIH is a skin disorder characterized by congenital ichthyosis associated with the presence of less than the normal amount of hair. Belongs to the peptidase S1 family.

Protein type: EC 3.4.21.109; Membrane protein, integral; Protease

Chromosomal Location of Human Ortholog: 11q24-q25

Cellular Component: extrinsic to plasma membrane; extracellular space; integral to plasma membrane; basolateral plasma membrane; plasma membrane

Molecular Function: serine-type peptidase activity; serine-type endopeptidase activity

Biological Process: keratinocyte differentiation; proteolysis

Disease: Ichthyosis, Congenital, Autosomal Recessive 11

Similar Products

Product Notes

The MTSP1 st14 (Catalog #AAA6158753) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Matriptase (ST14, Suppressor Of Tumorigenicity 14 Protein, Membrane-type Serine Protease 1, Serine Protease 14, Serine Protease TADG-15, Tumor-associated Differentially-expressed Gene 15 Protein, SNC19, Epitin, Prostamin, TADG15, MT-SP1, MTSP1, PRSS14) (P reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Matriptase can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MTSP1 st14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Matriptase, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.