Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human LMX1B Monoclonal Antibody | anti-LMX1B antibody

LMX1B (LIM Homeobox Transcription Factor 1-beta, LIM/Homeobox Protein 1.2, LMX-1.2, LIM/Homeobox Protein LMX1B, MGC138325, MGC142051) (FITC)

Gene Names
LMX1B; NPS1; LMX1.2
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LMX1B; Monoclonal Antibody; LMX1B (LIM Homeobox Transcription Factor 1-beta; LIM/Homeobox Protein 1.2; LMX-1.2; LIM/Homeobox Protein LMX1B; MGC138325; MGC142051) (FITC); anti-LMX1B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D12
Specificity
Recognizes human LMX1B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-LMX1B antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from human LMX1B (NP_002307) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCMEKIAPTEFVMRALE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to LMX1B on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to LMX1B on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged LMX1B is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LMX1B is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-LMX1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46.5 kDa (418 aa)
NCBI Official Full Name
LIM homeobox transcription factor 1-beta isoform 1
NCBI Official Synonym Full Names
LIM homeobox transcription factor 1 beta
NCBI Official Symbol
LMX1B
NCBI Official Synonym Symbols
NPS1; LMX1.2
NCBI Protein Information
LIM homeobox transcription factor 1-beta
UniProt Protein Name
LIM homeobox transcription factor 1-beta
Protein Family
UniProt Gene Name
LMX1B
UniProt Synonym Gene Names
LMX-1.2
UniProt Entry Name
LMX1B_HUMAN

NCBI Description

This gene encodes a member of LIM-homeodomain family of proteins containing two N-terminal zinc-binding LIM domains, 1 homeodomain, and a C-terminal glutamine-rich domain. It functions as a transcription factor, and is essential for the normal development of dorsal limb structures, the glomerular basement membrane, the anterior segment of the eye, and dopaminergic and serotonergic neurons. Mutations in this gene are associated with nail-patella syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]

Uniprot Description

LMX1B: Essential for the specification of dorsal limb fate at both the zeugopodal and autopodal levels. Defects in LMX1B are the cause of nail-patella syndrome (NPS); also known as onychoosteodysplasia. NPS is a disease that cause abnormal skeletal patterning and renal dysplasia. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 9q33.3

Cellular Component: nucleus

Molecular Function: protein binding; zinc ion binding; sequence-specific DNA binding; transcription factor activity

Biological Process: neuron differentiation; organ growth; cell proliferation; collagen fibril organization; transcription, DNA-dependent; regulation of transcription, DNA-dependent; dorsal/ventral pattern formation; in utero embryonic development; multicellular organismal development; midbrain development; neuron migration; cerebellum morphogenesis; positive regulation of transcription from RNA polymerase II promoter; limb morphogenesis; central nervous system neuron development

Disease: Nail-patella Syndrome

Research Articles on LMX1B

Similar Products

Product Notes

The LMX1B lmx1b (Catalog #AAA6148033) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LMX1B (LIM Homeobox Transcription Factor 1-beta, LIM/Homeobox Protein 1.2, LMX-1.2, LIM/Homeobox Protein LMX1B, MGC138325, MGC142051) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LMX1B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LMX1B lmx1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LMX1B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.