Mouse anti-Human, Rat HK2 Monoclonal Antibody | anti-HK2 antibody

HK2 (Hexokinase-2, Hexokinase Type II, HK II, HKII, HK2, HXK2, DKFZp686M1669, Muscle Form Hexokinase) (Biotin)

Cat. Num. AAA6142289

• Gene Names: HK2; HKII; HXK2
• Reactivity: Human, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HK2; Monoclonal Antibody; HK2 (Hexokinase-2; Hexokinase Type II; HK II; HKII; HXK2; DKFZp686M1669; Muscle Form Hexokinase) (Biotin); anti-HK2 antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4H1
• Specificity: Recognizes human HK2. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-HK2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa818-917 from human HK2 (AAH21116) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IVKEVCTVVARRAAQLCGAGMAAVVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKGAALITAVACRIREAGQR
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(HK2 monoclonal antibody Western Blot analysis of HK2 expression in PC-12)

Western Blot (WB)

(HK2 monoclonal antibody. Western Blot analysis of HK2 expression in A-431)

Testing Data

(Detection limit for recombinant GST tagged HK2 is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-HK2 antibody

In vertebrates there are four major glucose-phosphorylating isoenzymes, designated hexokinase I, II, III, and IV. Hexokinase is an allosteric enzyme inhibited by its product GLC-6-P. Hexokinase activity is involved in the first step in several metabolic pathways. HK3 is bound to the outer mitochondrial membrane. Its hydrophobic N-terminal sequence may be involved in membrane bindng. It is the predominant hexokinase isozyme expressed in insuline-responsive tissues such as skeletal muscle. The N- and C-terminal halves of this hexokinase show extensive sequence similarity to each other. The catalytic activity is associated with the C-terminus while regulatory function is associated wiht the N-terminus. Although found in NIDDM patients, genetic variations of HK2 do not contribute to the disease.

Product Categories/Family for anti-HK2 antibody

Antibodies; Enzymes

References

1. Expression and role in glycolysis of human ADP-dependent glucokinase. Richter S, Richter JP, Mehta SY, Gribble AM, Sutherland-Smith AJ, Stowell KM, Print CG, Ronimus RS, Wilson WR.Mol Cell Biochem. 2012 Jan 5.

NCBI and Uniprot Product Information

• NCBI GI #: 18088967
• NCBI GeneID: 3099
• Molecular Weight: 102,380 Da
• NCBI Official Full Name: Homo sapiens hexokinase 2, mRNA
• NCBI Official Synonym Full Names: hexokinase 2
• NCBI Official Symbol: HK2
• NCBI Official Synonym Symbols: HKII; HXK2
• NCBI Protein Information: hexokinase-2
• Protein Family: Probable histidine kinase

NCBI Description

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. [provided by RefSeq, Apr 2009]