Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human, Rat HK2 Monoclonal Antibody | anti-HK2 antibody

HK2 (Hexokinase-2, Hexokinase Type II, HK II, HKII, HK2, HXK2, DKFZp686M1669, Muscle Form Hexokinase) (FITC)

Gene Names
HK2; HKII; HXK2
Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HK2; Monoclonal Antibody; HK2 (Hexokinase-2; Hexokinase Type II; HK II; HKII; HXK2; DKFZp686M1669; Muscle Form Hexokinase) (FITC); anti-HK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4H1
Specificity
Recognizes human HK2. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-HK2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa818-917 from human HK2 (AAH21116) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IVKEVCTVVARRAAQLCGAGMAAVVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKGAALITAVACRIREAGQR
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(HK2 monoclonal antibody Western Blot analysis of HK2 expression in PC-12)

Western Blot (WB) (HK2 monoclonal antibody Western Blot analysis of HK2 expression in PC-12)

Western Blot (WB)

(HK2 monoclonal antibody. Western Blot analysis of HK2 expression in A-431)

Western Blot (WB) (HK2 monoclonal antibody. Western Blot analysis of HK2 expression in A-431)

Testing Data

(Detection limit for recombinant GST tagged HK2 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HK2 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-HK2 antibody
In vertebrates there are four major glucose-phosphorylating isoenzymes, designated hexokinase I, II, III, and IV. Hexokinase is an allosteric enzyme inhibited by its product GLC-6-P. Hexokinase activity is involved in the first step in several metabolic pathways. HK3 is bound to the outer mitochondrial membrane. Its hydrophobic N-terminal sequence may be involved in membrane bindng. It is the predominant hexokinase isozyme expressed in insuline-responsive tissues such as skeletal muscle. The N- and C-terminal halves of this hexokinase show extensive sequence similarity to each other. The catalytic activity is associated with the C-terminus while regulatory function is associated wiht the N-terminus. Although found in NIDDM patients, genetic variations of HK2 do not contribute to the disease.
Product Categories/Family for anti-HK2 antibody
References
1. Expression and role in glycolysis of human ADP-dependent glucokinase. Richter S, Richter JP, Mehta SY, Gribble AM, Sutherland-Smith AJ, Stowell KM, Print CG, Ronimus RS, Wilson WR.Mol Cell Biochem. 2012 Jan 5.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
102,380 Da
NCBI Official Full Name
Homo sapiens hexokinase 2, mRNA
NCBI Official Synonym Full Names
hexokinase 2
NCBI Official Symbol
HK2
NCBI Official Synonym Symbols
HKII; HXK2
NCBI Protein Information
hexokinase-2
Protein Family

NCBI Description

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. [provided by RefSeq, Apr 2009]

Research Articles on HK2

Similar Products

Product Notes

The HK2 (Catalog #AAA6147592) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HK2 (Hexokinase-2, Hexokinase Type II, HK II, HKII, HK2, HXK2, DKFZp686M1669, Muscle Form Hexokinase) (FITC) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HK2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HK2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.