<
Western Blot (WB)
(Western Blot detection against Immunogen (37.84kD).)
Mouse anti-Human, Rat SEC22B Monoclonal Antibody
SEC22B (SEC22 Vesicle-trafficking Protein Homolog B, Vesicle-trafficking Protein SEC22b, ER-Golgi SNARE of 24 kDa, ERS-24, ERS24, SEC22 Vesicle-trafficking Protein-like 1, SEC22L1)
Reactivity
Human, Rat
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
SEC22B; Monoclonal Antibody; SEC22B (SEC22 Vesicle-trafficking Protein Homolog B; Vesicle-trafficking Protein SEC22b; ER-Golgi SNARE of 24 kDa; ERS-24; ERS24; SEC22 Vesicle-trafficking Protein-like 1; SEC22L1); Anti -SEC22B (SEC22 Vesicle-trafficking Protein Homolog B; anti-SEC22B antibody
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a Lambda
Clone Number
1E1
Specificity
Recognizes human SEC22L1. Species Crossreactivity: rat.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPY
Applicable Applications for anti-SEC22B antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in ELISA, Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa1-110 from SEC22L1 (NP_004883) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37.84kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37.84kD).)
Western Blot (WB)
(SEC22L1 monoclonal antibody Western Blot analysis of SEC22L1 expression in HeLa.)
Western Blot (WB)
(SEC22L1 monoclonal antibody Western Blot analysis of SEC22L1 expression in HeLa.)
Western Blot (WB)
(SEC22L1 monoclonal antibody Western Blot analysis of SEC22L1 expression in PC-12.)
Western Blot (WB)
(SEC22L1 monoclonal antibody Western Blot analysis of SEC22L1 expression in PC-12.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to SEC22L1 on HeLa cell. [antibody concentration 10ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to SEC22L1 on HeLa cell. [antibody concentration 10ug/ml])
Testing Data
(Detection limit for recombinant GST tagged SEC22L1 is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged SEC22L1 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-SEC22B antibody
Similar Products
Product Notes
The SEC22B (Catalog #AAA6013635) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SEC22B (SEC22 Vesicle-trafficking Protein Homolog B, Vesicle-trafficking Protein SEC22b, ER-Golgi SNARE of 24 kDa, ERS-24, ERS24, SEC22 Vesicle-trafficking Protein-like 1, SEC22L1) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SEC22B can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in ELISA, Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the SEC22B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVLLTMIARV ADGLPLAASM QEDEQSGRDL QQYQSQAKQL FRKLNEQSPT RCTLEAGAMT FHYIIEQGVC YLVLCEAAFP KKLAFAYLED LHSEFDEQHG KKVPTVSRPY. It is sometimes possible for the material contained within the vial of "SEC22B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
