Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SEC22B monoclonal antibody (M03), clone 5A10. Western Blot analysis of SEC22B expression in HeLa.)

Mouse SEC22B Monoclonal Antibody | anti-SEC22B antibody

SEC22B (SEC22 Vesicle Trafficking Protein Homolog B (S. cerevisiae), ERS-24, SEC22L1) (HRP)

Gene Names
SEC22B; ERS-24; SEC22L1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
SEC22B; Monoclonal Antibody; SEC22B (SEC22 Vesicle Trafficking Protein Homolog B (S. cerevisiae); ERS-24; SEC22L1) (HRP); SEC22 Vesicle Trafficking Protein Homolog B (S. cerevisiae); SEC22L1; anti-SEC22B antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a, lambda
Clone Number
5A10
Specificity
Recognizes SEC22B.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-SEC22B antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SEC22B (NP_004883, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPY
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SEC22B monoclonal antibody (M03), clone 5A10. Western Blot analysis of SEC22B expression in HeLa.)

Western Blot (WB) (SEC22B monoclonal antibody (M03), clone 5A10. Western Blot analysis of SEC22B expression in HeLa.)

Western Blot (WB)

(SEC22B monoclonal antibody (M03), clone 5A10. Western Blot analysis of SEC22B expression in PC-12.)

Western Blot (WB) (SEC22B monoclonal antibody (M03), clone 5A10. Western Blot analysis of SEC22B expression in PC-12.)
Product Categories/Family for anti-SEC22B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23.3 kDa (205aa)
NCBI Official Full Name
vesicle-trafficking protein SEC22b
NCBI Official Synonym Full Names
SEC22 homolog B, vesicle trafficking protein (gene/pseudogene)
NCBI Official Symbol
SEC22B
NCBI Official Synonym Symbols
ERS-24; SEC22L1
NCBI Protein Information
vesicle-trafficking protein SEC22b
UniProt Protein Name
Vesicle-trafficking protein SEC22b
UniProt Gene Name
SEC22B
UniProt Synonym Gene Names
SEC22L1; ERS-24; ERS24
UniProt Entry Name
SC22B_HUMAN

NCBI Description

The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It seems to complex with SNARE and it is thought to play a role in the ER-Golgi protein trafficking. This protein has strong similarity to Mus musculus and Cricetulus griseus proteins.[provided by RefSeq, Sep 2009]

Uniprot Description

SEC22B: SNARE involved in targeting and fusion of ER-derived transport vesicles with the Golgi complex as well as Golgi-derived retrograde transport vesicles with the ER. Belongs to the synaptobrevin family.

Protein type: Vesicle; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q21.1

Cellular Component: Golgi membrane; endoplasmic reticulum membrane; ER-Golgi intermediate compartment membrane; integral to membrane; ER-Golgi intermediate compartment; melanosome

Molecular Function: protein binding; syntaxin binding

Biological Process: ER to Golgi vesicle-mediated transport; protein transport; positive regulation of protein catabolic process; regulation of organelle organization and biogenesis

Research Articles on SEC22B

Similar Products

Product Notes

The SEC22B sec22b (Catalog #AAA6182639) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SEC22B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SEC22B sec22b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SEC22B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.