Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human, Rat SEC22B Monoclonal Antibody | anti-SEC22B antibody

SEC22B (SEC22 Vesicle-trafficking Protein Homolog B, Vesicle-trafficking Protein SEC22b, ER-Golgi SNARE of 24kD, ERS-24, ERS24, SEC22 Vesicle-trafficking Protein-like 1, SEC22L1) (HRP)

Gene Names
SEC22B; ERS-24; SEC22L1
Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SEC22B; Monoclonal Antibody; SEC22B (SEC22 Vesicle-trafficking Protein Homolog B; Vesicle-trafficking Protein SEC22b; ER-Golgi SNARE of 24kD; ERS-24; ERS24; SEC22 Vesicle-trafficking Protein-like 1; SEC22L1) (HRP); anti-SEC22B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a, lambda
Clone Number
1E1
Specificity
Recognizes human SEC22L1. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-SEC22B antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from SEC22L1 (NP_004883) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPY
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(SEC22L1 monoclonal antibody Western Blot analysis of SEC22L1 expression in HeLa.)

Western Blot (WB) (SEC22L1 monoclonal antibody Western Blot analysis of SEC22L1 expression in HeLa.)

Western Blot (WB)

(SEC22L1 monoclonal antibody Western Blot analysis of SEC22L1 expression in PC-12.)

Western Blot (WB) (SEC22L1 monoclonal antibody Western Blot analysis of SEC22L1 expression in PC-12.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SEC22L1 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SEC22L1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SEC22L1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SEC22L1 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-SEC22B antibody
References
1. A VAMP7/Vti1a SNARE complex distinguishes a non-conventional traffic route to the cell surface used by KChIP1 and Kv4 potassium channels. Flowerdew SE, Burgoyne RD.Biochem J. 2009 Mar 15;418(3):529-40. 2.Quantitative and temporal proteome analysis of butyrate-treated colorectal cancer cells. Tan HT, Tan S, Lin Q, Lim TK, Hew CL, Chung MC.Mol Cell Proteomics. 2008 Jun;7(6):1174-85. Epub 2008 Mar 14.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23.3 kDa (205aa)
NCBI Official Full Name
vesicle-trafficking protein SEC22b
NCBI Official Synonym Full Names
SEC22 homolog B, vesicle trafficking protein (gene/pseudogene)
NCBI Official Symbol
SEC22B
NCBI Official Synonym Symbols
ERS-24; SEC22L1
NCBI Protein Information
vesicle-trafficking protein SEC22b
UniProt Protein Name
Vesicle-trafficking protein SEC22b
UniProt Gene Name
SEC22B
UniProt Synonym Gene Names
SEC22L1; ERS-24; ERS24
UniProt Entry Name
SC22B_HUMAN

NCBI Description

The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It seems to complex with SNARE and it is thought to play a role in the ER-Golgi protein trafficking. This protein has strong similarity to Mus musculus and Cricetulus griseus proteins.[provided by RefSeq, Sep 2009]

Uniprot Description

SEC22B: SNARE involved in targeting and fusion of ER-derived transport vesicles with the Golgi complex as well as Golgi-derived retrograde transport vesicles with the ER. Belongs to the synaptobrevin family.

Protein type: Vesicle; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q21.1

Cellular Component: Golgi membrane; endoplasmic reticulum membrane; ER-Golgi intermediate compartment membrane; integral to membrane; ER-Golgi intermediate compartment; melanosome

Molecular Function: protein binding; syntaxin binding

Biological Process: ER to Golgi vesicle-mediated transport; protein transport; positive regulation of protein catabolic process; regulation of organelle organization and biogenesis

Research Articles on SEC22B

Similar Products

Product Notes

The SEC22B sec22b (Catalog #AAA6154864) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SEC22B (SEC22 Vesicle-trafficking Protein Homolog B, Vesicle-trafficking Protein SEC22b, ER-Golgi SNARE of 24kD, ERS-24, ERS24, SEC22 Vesicle-trafficking Protein-like 1, SEC22L1) (HRP) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SEC22B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SEC22B sec22b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SEC22B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.