Western Blot (WB)
(Western Blot detection against Immunogen using MBS6008087 (47.78kD).)
Mouse anti-Human CLCF1 Monoclonal Antibody | anti-clcf1 antibody
CLCF1 (Cardiotrophin-like Cytokine Factor 1, B-cell-stimulating Factor 3, BSF-3, Novel Neurotrophin-1, NNT-1, BSF3, CLC, NNT1)
Gene Names
clcf1; clc; nr6; bsf3; nnt1; ciss2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Ascites
Synonyms
CLCF1; Monoclonal Antibody; CLCF1 (Cardiotrophin-like Cytokine Factor 1; B-cell-stimulating Factor 3; BSF-3; Novel Neurotrophin-1; NNT-1; BSF3; CLC; NNT1); Anti -CLCF1 (Cardiotrophin-like Cytokine Factor 1; anti-clcf1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgM,k
Clone Number
7E10
Specificity
Recognizes human CLCF1.
Purity/Purification
Ascites
Form/Format
Supplied as a liquid in ascites fluid.
Sequence
NRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF*
Applicable Applications for anti-clcf1 antibody
ELISA (EL/EIA), Western Blot (WB). Other applications not tested.
Application Notes
Optimal dilutions to be determined by the researcher.
Immunogen
Full-length recombinant corresponding to aa29-226 from CLCF1 (AAH12939.1) with GST tag.
Preparation and Storage
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen using MBS6008087 (47.78kD).)
Western Blot (WB)
(Western Blot detection against Immunogen using MBS6008087 (47.78kD).)
Related Product Information for anti-clcf1 antibody
This gene is a member of the glycoprotein (gp)130 cytokine family and encodes cardiotrophin-like cytokine factor 1 (CLCF1). CLCF1 forms a heterodimer complex with cytokine receptor-like factor 1 (CRLF1). This dimer competes with ciliary neurotrophic factor (CNTF) for binding to the ciliary neurotrophic factor receptor (CNTFR) complex, and activates the Jak-STAT signaling cascade. CLCF1 can be actively secreted from cells by forming a complex with soluble type I CRLF1 or soluble CNTFR. CLCF1 is a potent neurotrophic factor, B-cell stimulatory agent and neuroendocrine modulator of pituitary corticotroph function. Defects in CLCF1 cause cold-induced sweating syndrome 2 (CISS2). This syndrome is characterized by a profuse sweating after exposure to cold as well as congenital physical abnormalities of the head and spine. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Product Categories/Family for anti-clcf1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
cardiotrophin-like cytokine factor 1
NCBI Official Synonym Full Names
cardiotrophin-like cytokine factor 1
NCBI Official Symbol
clcf1
NCBI Official Synonym Symbols
clc; nr6; bsf3; nnt1; ciss2
NCBI Protein Information
cardiotrophin-like cytokine factor 1
Protein Family
Similar Products
Product Notes
The clcf1 (Catalog #AAA6008087) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CLCF1 (Cardiotrophin-like Cytokine Factor 1, B-cell-stimulating Factor 3, BSF-3, Novel Neurotrophin-1, NNT-1, BSF3, CLC, NNT1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLCF1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Other applications not tested. Optimal dilutions to be determined by the researcher. Researchers should empirically determine the suitability of the clcf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NRTGDPGPGP SIQKTYDLTR YLEHQLRSLA GTYLNYLGPP FNEPDFNPPR LGAETLPRAT VDLEVWRSLN DKLRLTQNYE AYSHLLCYLR GLNRQAATAE LRRSLAHFCT SLQGLLGSIA GVMAALGYPL PQPLPGTEPT WTPGPAHSDF LQKMDDFWLL KELQTWLWRS AKDFNRLKKK MQPPAAAVTL HLGAHGF*. It is sometimes possible for the material contained within the vial of "CLCF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
