Mouse anti-Human ARL5 Monoclonal Antibody | anti-ARL5A antibody

ARL5 (ADP-ribosylation factor-like protein 5A, ARL5A, ARFLP5)

Cat. Num. AAA6000256

• Gene Names: ARL5A; ARL5; ARFLP5
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ARL5; Monoclonal Antibody; ARL5 (ADP-ribosylation factor-like protein 5A; ARL5A; ARFLP5); Anti -ARL5 (ADP-ribosylation factor-like protein 5A; anti-ARL5A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1F12-1A6
• Specificity: Recognizes human ARL5.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR*

• Applicable Applications for anti-ARL5A antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Full length recombinant corresponding to aa1-180 from human ARL5 (AAH01254) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (45.8kD).)

Related Product Information for anti-ARL5A antibody

ARL5 belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Product Categories/Family for anti-ARL5A antibody

Antibodies; Abs to GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 6912244
• NCBI GeneID: 26225
• NCBI Accession #: NP_036229.1
• NCBI GenBank Nucleotide #: NM_012097.3
• UniProt Accession #: Q9Y689; Q580I5
• Molecular Weight: 20,728 Da
• NCBI Official Full Name: ADP-ribosylation factor-like protein 5A isoform 1
• NCBI Official Synonym Full Names: ADP-ribosylation factor-like 5A
• NCBI Official Symbol: ARL5A
• NCBI Official Synonym Symbols: ARL5; ARFLP5
• NCBI Protein Information: ADP-ribosylation factor-like protein 5A; ADP-ribosylation factor-like 5
• UniProt Protein Name: ADP-ribosylation factor-like protein 5A
• Protein Family: ADP-ribosylation factor-like protein
• UniProt Gene Name: ARL5A
• UniProt Synonym Gene Names: ARFLP5; ARL5
• UniProt Entry Name: ARL5A_HUMAN

NCBI Description

The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes. [provided by RefSeq, Jul 2008]

Uniprot Description

ARL5A: Lacks ADP-ribosylation enhancing activity. Belongs to the small GTPase superfamily. Arf family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: G protein, monomeric, ARF; G protein, monomeric

Chromosomal Location of Human Ortholog: 2q23.3

Cellular Component: intracellular

Molecular Function: GTP binding

Biological Process: small GTPase mediated signal transduction