Western Blot (WB)
(WB Suggested Anti-ARL5A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)
Rabbit ARL5A Polyclonal Antibody | anti-ARL5A antibody
ARL5A antibody - middle region
Gene Names
ARL5A; ARL5; ARFLP5
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ARL5A; Polyclonal Antibody; ARL5A antibody - middle region; anti-ARL5A antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQA
Sequence Length
179
Applicable Applications for anti-ARL5A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 91%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ARL5A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ARL5A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)
Western Blot (WB)
(WB Suggested Anti-ARL5A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)
Related Product Information for anti-ARL5A antibody
This is a rabbit polyclonal antibody against ARL5A. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ARL5A lacks ADP-ribosylation enhancing activity.The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
Target Description: ARL5A lacks ADP-ribosylation enhancing activity.The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
Product Categories/Family for anti-ARL5A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
ADP-ribosylation factor-like protein 5A isoform 1
NCBI Official Synonym Full Names
ADP ribosylation factor like GTPase 5A
NCBI Official Symbol
ARL5A
NCBI Official Synonym Symbols
ARL5; ARFLP5
NCBI Protein Information
ADP-ribosylation factor-like protein 5A
UniProt Protein Name
ADP-ribosylation factor-like protein 5A
Protein Family
UniProt Gene Name
ARL5A
UniProt Synonym Gene Names
ARFLP5; ARL5
UniProt Entry Name
ARL5A_HUMAN
NCBI Description
The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes. [provided by RefSeq, Jul 2008]
Uniprot Description
ARL5A: Lacks ADP-ribosylation enhancing activity. Belongs to the small GTPase superfamily. Arf family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: G protein, monomeric, ARF; G protein, monomeric
Chromosomal Location of Human Ortholog: 2q23.3
Cellular Component: intracellular
Molecular Function: GTP binding
Biological Process: small GTPase mediated signal transduction
Research Articles on ARL5A
Similar Products
Product Notes
The ARL5A arl5a (Catalog #AAA3212383) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARL5A antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ARL5A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARL5A arl5a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YKMLAHEDLR KAGLLIFANK QDVKECMTVA EISQFLKLTS IKDHQWHIQA. It is sometimes possible for the material contained within the vial of "ARL5A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
