Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

BCL3 blocking peptide

BCL3 Peptide - middle region

Gene Names
BCL3; BCL4; D19S37
Reactivity
Human
Synonyms
BCL3; BCL3 Peptide - middle region; BCL3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: MVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLS
Sequence Length
454
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for BCL3 blocking peptide
This is a synthetic peptide designed for use in combination with anti- BCL3 Antibody, made

Target Description: This gene is a proto-oncogene candidate. It is identified by its translocation into the immunoglobulin alpha-locus in some cases of B-cell leukemia. The protein encoded by this gene contains seven ankyrin repeats, which are most closely related to those found in I kappa B proteins. This protein functions as a transcriptional co-activator that activates through its association with NF-kappa B homodimers. The expression of this gene can be induced by NF-kappa B, which forms a part of the autoregulatory loop that controls the nuclear residence of p50 NF-kappa B.
Product Categories/Family for BCL3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
602
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49 kDa
NCBI Official Full Name
B-cell lymphoma 3 protein
NCBI Official Synonym Full Names
BCL3 transcription coactivator
NCBI Official Symbol
BCL3
NCBI Official Synonym Symbols
BCL4; D19S37
NCBI Protein Information
B-cell lymphoma 3 protein
UniProt Protein Name
B-cell lymphoma 3 protein
Protein Family
UniProt Gene Name
BCL3
UniProt Synonym Gene Names
BCL4; D19S37; BCL-3
UniProt Entry Name
BCL3_HUMAN

NCBI Description

This gene is a proto-oncogene candidate. It is identified by its translocation into the immunoglobulin alpha-locus in some cases of B-cell leukemia. The protein encoded by this gene contains seven ankyrin repeats, which are most closely related to those found in I kappa B proteins. This protein functions as a transcriptional co-activator that activates through its association with NF-kappa B homodimers. The expression of this gene can be induced by NF-kappa B, which forms a part of the autoregulatory loop that controls the nuclear residence of p50 NF-kappa B. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Contributes to the regulation of transcriptional activation of NF-kappa-B target genes. In the cytoplasm, inhibits the nuclear translocation of the NF-kappa-B p50 subunit. In the nucleus, acts as transcriptional activator that promotes transcription of NF-kappa-B target genes. Contributes to the regulation of cell proliferation

By similarity. Ref.4

Subunit structure: Component of a complex consisting of the NF-kappa-B p52-p52 homodimer and BCL3. Component of a complex consisting of the NF-kappa-B p50-p50 homodimer and BCL3. Interacts with N4BP2, COPS5 and PIR. Interacts with CYLD

By similarity. Ref.4 Ref.5 Ref.6 Ref.7

Subcellular location: Nucleus. Cytoplasm

By similarity. Cytoplasm › perinuclear region

By similarity. Note: Ubiquitination via 'Lys-63'-linked ubiquitin chains is required for nuclear accumulation

By similarity.

Post-translational modification: Polyubiquitinated. Ubiquitination via 'Lys-63'-linked ubiquitin chains is required for nuclear accumulation. Deubiquitinated by CYLD, which acts on 'Lys-63'-linked ubiquitin chains. Deubiquitination by CYLD prevents nuclear accumulation

By similarity.Activated by phosphorylation.

Involvement in disease: A chromosomal aberration involving BCL3 may be a cause of B-cell chronic lymphocytic leukemia (B-CLL). Translocation t(14;19)(q32;q13.1) with immunoglobulin gene regions.

Sequence similarities: Contains 7 ANK repeats.

Caution: It is uncertain whether Met-1 or Met-9 is the initiator.

Sequence caution: The sequence AAA51815.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence AAA51816.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence AAH64993.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Research Articles on BCL3

Similar Products

Product Notes

The BCL3 bcl3 (Catalog #AAA3247029) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The BCL3 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: MVARSRRVID ILRGKATRPA STSQPDPSPD RSANTSPESS SRLSSNGLLS. It is sometimes possible for the material contained within the vial of "BCL3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.