Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BCL3Sample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human BCL3 Polyclonal Antibody | anti-BCL3 antibody

BCL3 Antibody - middle region

Gene Names
BCL3; BCL4; D19S37
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
BCL3; Polyclonal Antibody; BCL3 Antibody - middle region; anti-BCL3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLS
Sequence Length
454
Applicable Applications for anti-BCL3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BCL3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BCL3Sample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BCL3Sample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-BCL3 antibody
This gene is a proto-oncogene candidate. It is identified by its translocation into the immunoglobulin alpha-locus in some cases of B-cell leukemia. The protein encoded by this gene contains seven ankyrin repeats, which are most closely related to those found in I kappa B proteins. This protein functions as a transcriptional co-activator that activates through its association with NF-kappa B homodimers. The expression of this gene can be induced by NF-kappa B, which forms a part of the autoregulatory loop that controls the nuclear residence of p50 NF-kappa B.
Product Categories/Family for anti-BCL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
602
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49 kDa
NCBI Official Full Name
B-cell lymphoma 3 protein
NCBI Official Synonym Full Names
BCL3 transcription coactivator
NCBI Official Symbol
BCL3
NCBI Official Synonym Symbols
BCL4; D19S37
NCBI Protein Information
B-cell lymphoma 3 protein
UniProt Protein Name
B-cell lymphoma 3 protein
Protein Family
UniProt Gene Name
BCL3
UniProt Synonym Gene Names
BCL4; D19S37; BCL-3
UniProt Entry Name
BCL3_HUMAN

NCBI Description

This gene is a proto-oncogene candidate. It is identified by its translocation into the immunoglobulin alpha-locus in some cases of B-cell leukemia. The protein encoded by this gene contains seven ankyrin repeats, which are most closely related to those found in I kappa B proteins. This protein functions as a transcriptional co-activator that activates through its association with NF-kappa B homodimers. The expression of this gene can be induced by NF-kappa B, which forms a part of the autoregulatory loop that controls the nuclear residence of p50 NF-kappa B. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Contributes to the regulation of transcriptional activation of NF-kappa-B target genes. In the cytoplasm, inhibits the nuclear translocation of the NF-kappa-B p50 subunit. In the nucleus, acts as transcriptional activator that promotes transcription of NF-kappa-B target genes. Contributes to the regulation of cell proliferation

By similarity. Ref.4

Subunit structure: Component of a complex consisting of the NF-kappa-B p52-p52 homodimer and BCL3. Component of a complex consisting of the NF-kappa-B p50-p50 homodimer and BCL3. Interacts with N4BP2, COPS5 and PIR. Interacts with CYLD

By similarity. Ref.4 Ref.5 Ref.6 Ref.7

Subcellular location: Nucleus. Cytoplasm

By similarity. Cytoplasm › perinuclear region

By similarity. Note: Ubiquitination via 'Lys-63'-linked ubiquitin chains is required for nuclear accumulation

By similarity.

Post-translational modification: Polyubiquitinated. Ubiquitination via 'Lys-63'-linked ubiquitin chains is required for nuclear accumulation. Deubiquitinated by CYLD, which acts on 'Lys-63'-linked ubiquitin chains. Deubiquitination by CYLD prevents nuclear accumulation

By similarity.Activated by phosphorylation.

Involvement in disease: A chromosomal aberration involving BCL3 may be a cause of B-cell chronic lymphocytic leukemia (B-CLL). Translocation t(14;19)(q32;q13.1) with immunoglobulin gene regions.

Sequence similarities: Contains 7 ANK repeats.

Caution: It is uncertain whether Met-1 or Met-9 is the initiator.

Sequence caution: The sequence AAA51815.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence AAA51816.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence AAH64993.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Research Articles on BCL3

Similar Products

Product Notes

The BCL3 bcl3 (Catalog #AAA3222357) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BCL3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BCL3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BCL3 bcl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MVARSRRVID ILRGKATRPA STSQPDPSPD RSANTSPESS SRLSSNGLLS. It is sometimes possible for the material contained within the vial of "BCL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.